KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1569Help
Entry
Calkr_1569        CDS       T01356                                 

Definition
asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Calkr_1569
Enzymes [BR:cki01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Calkr_1569
Peptidases [BR:cki01002]
 Cysteine Peptidases
  Family C44
   Calkr_1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1627101..1628936
Genome map
AA seq 611 aa AA seqDB search
MCGFSGWICFSADISEFQDVITKMTDVLSHRGPDEEGYYITKHALLGHKRLTIIDPEGGK
QPMIKFHNQQKFIIVYNGELYNTQELRAKLQSLGYHFSSYSDTEVVLTSYIQWKEECVKY
LNGIFAFAVFNETKNELFIARDHLGVKPLFFSLKNDNFIFASEIKSLLRHPLISTKVDKE
GIFELIGLCPARSPFSAIFKDIIELPPAHYVIYSKNRYEIKEYWQLKPEKFDKTVDETIE
IVKNLVKDAITRQLVSDFEICCFLSGGLDSTIITAISANQLRKEGKRLKSFSIDYKDNAK
YYKFNQYQPTLDSTYAKIASRSIGTDHIVVEIDNELLCDALLHATVANDLPGMADIDSSL
FLFTSEVRKYAKVALSGECADEIFGGYPWYWREDYKNFETFPWSPSLEFRKNILSKKYSK
FELEEYVNSKYKESVGKVNYLDSDSQEDVRHRILYYLNVKWFMVTLLNRKDRMSMANSLE
VRVPFADYRIVELLYNVPWKIKYLENMEKGLLRRSFEGIIPNEIKNRKKSPYPKTYNPEF
LKKTKQKVLETIKNNSPVFEIIDKTYLENITEKEFFPLDKPWFGQLMTLPQFFGYIIQLD
FWAKTYNVDFE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggatttagcggatggatatgctttagcgcagacatctctgaattccaggatgta
ataacaaagatgacagatgtacttagtcaccgtggacctgatgaagaaggatattacatc
accaaacatgctctgctcgggcacaaacgactcaccattattgaccctgaaggtggtaaa
cagccaatgatcaaattccataatcaacaaaaatttattatagtttacaatggtgagctt
tacaacactcaagagcttcgggcaaagcttcaaagcttagggtatcatttcagttcatac
tcagacaccgaagttgtgttgacctcatatattcaatggaaagaagagtgtgtgaaatat
ttaaatggtatatttgcctttgctgtttttaatgaaaccaaaaatgagctttttatagct
cgggatcatttaggagtaaaaccgctatttttctctcttaaaaatgacaattttattttt
gcttcagaaataaaatctcttcttaggcatcctctaatctctactaaggtggacaaagag
ggtatttttgagcttataggtctttgccctgcaaggtctccattttcagcaattttcaaa
gatatcatagaacttccacctgcacattatgtaatatacagcaaaaatagatatgaaata
aaagaatattggcagttaaaacccgaaaagtttgacaaaacagtagatgaaaccattgag
atagttaaaaaccttgtcaaagatgcaataacaagacagcttgtttctgactttgaaata
tgctgctttctatcaggcgggttggattcgaccattattacagctatttctgctaaccag
ttaagaaaagaaggaaaaagattaaaaagtttttctattgattataaggataatgcaaaa
tattataaatttaatcagtatcagcccaccttagacagcacctatgctaagatagcttca
agaagcataggtacagaccacattgtagttgaaattgacaatgaacttttatgcgatgcc
ctcttacatgccacagttgcaaatgaccttcctggcatggctgacattgactcatcactt
ttcttgttcacaagtgaagtgagaaaatatgcaaaggttgccctatcgggtgagtgcgct
gatgagatttttggtggatatccttggtattggagagaggattacaaaaatttcgaaacc
tttccatggtcgccttcattagaatttagaaaaaatattctgtcgaaaaaatattcaaaa
tttgagctcgaagagtatgttaactcaaagtataaagagtcggttggaaaagtaaactac
cttgacagtgactctcaggaagacgtaagacatagaattttgtactacttgaatgttaag
tggtttatggtaacgcttttaaacagaaaagatagaatgagcatggcaaattctttggag
gtaagagttccatttgcagattatagaattgtagaacttttgtacaatgttccttggaag
ataaaataccttgaaaatatggaaaaaggacttttaaggcgttcatttgaaggaattatt
cccaatgaaataaagaatcgcaaaaaaagcccttatcctaaaacctataatcccgagttt
cttaaaaaaacaaagcaaaaggttttagagactataaaaaataactctcctgtatttgag
ataatagataagacttacttggaaaacataacagagaaagaatttttccccttagataaa
ccttggtttggtcagctaatgaccctcccacagttttttggatatatcatccagcttgat
ttttgggcaaagacctacaatgtagatttcgaataa

DBGET integrated database retrieval system