KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1704Help
Entry
Calkr_1704        CDS       T01356                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calkr_1704
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calkr_1704
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calkr_1704
Enzymes [BR:cki01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calkr_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1771202..1771972)
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFERLKKEGKKAFIGYVTFGYPSFEETLEVIKLVYSYVDILEIGFPFSDPIADG
EIIQKASIKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKRGIDRFFESSKACGVD
GVIIPDVSFEESFEFKEAAEKFGVTYIDLVSISSLERAKMIGKQSKGFLYCVSRKGVTGF
KGQIDDRIFTFLRELKTVTPTPLAVGFGIKGKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaggctaaaaaaagagggaaaaaaagctttcata
ggctatgtaacgtttgggtatccctcttttgaagagactcttgaggttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatggt
gaaattattcaaaaagcttctataaaagctcttagtgaaggtgttaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgctgtatgcaaac
acagtttacaaaaggggaattgataggttttttgaaagtagcaaagcttgcggtgtagat
ggcgttataatccccgatgtttcgttcgaggagagctttgagttcaaagaagcagctgaa
aagtttggtgttacttatattgaccttgtatctatatcttctcttgagagagccaagatg
ataggtaagcagtctaaaggttttttgtactgtgtttcaagaaaaggcgtgacaggtttt
aaagggcagattgatgacaggatttttactttcttgagagaactgaaaactgttacccca
acacctttggcagttggatttggtataaagggtaaagaagatgttcagaagttcaaagac
cttgcagatggtattgtcattggaagcgcaataatcacaaagatagatgaagggaaagac
aagcttgaagatttcttgaaagaaatttctgaaagtctaaaagacaaataa

DBGET integrated database retrieval system