KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1704Help
Entry
Calkr_1704        CDS       T01356                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00260  Glycine, serine and threonine metabolism
cki00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cki01100  Metabolic pathways
cki01110  Biosynthesis of secondary metabolites
cki01130  Biosynthesis of antibiotics
cki01230  Biosynthesis of amino acids
Module
cki_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calkr_1704
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calkr_1704
Enzymes [BR:cki01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calkr_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF627
Motif
Other DBs
NCBI-ProteinID: ADQ41194
UniProt: E4SAG9
Position
complement(1771202..1771972)
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFERLKKEGKKAFIGYVTFGYPSFEETLEVIKLVYSYVDILEIGFPFSDPIADG
EIIQKASIKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKRGIDRFFESSKACGVD
GVIIPDVSFEESFEFKEAAEKFGVTYIDLVSISSLERAKMIGKQSKGFLYCVSRKGVTGF
KGQIDDRIFTFLRELKTVTPTPLAVGFGIKGKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaggctaaaaaaagagggaaaaaaagctttcata
ggctatgtaacgtttgggtatccctcttttgaagagactcttgaggttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatggt
gaaattattcaaaaagcttctataaaagctcttagtgaaggtgttaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgctgtatgcaaac
acagtttacaaaaggggaattgataggttttttgaaagtagcaaagcttgcggtgtagat
ggcgttataatccccgatgtttcgttcgaggagagctttgagttcaaagaagcagctgaa
aagtttggtgttacttatattgaccttgtatctatatcttctcttgagagagccaagatg
ataggtaagcagtctaaaggttttttgtactgtgtttcaagaaaaggcgtgacaggtttt
aaagggcagattgatgacaggatttttactttcttgagagaactgaaaactgttacccca
acacctttggcagttggatttggtataaagggtaaagaagatgttcagaagttcaaagac
cttgcagatggtattgtcattggaagcgcaataatcacaaagatagatgaagggaaagac
aagcttgaagatttcttgaaagaaatttctgaaagtctaaaagacaaataa

DBGET integrated database retrieval system