KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1705Help
Entry
Calkr_1705        CDS       T01356                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calkr_1705
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calkr_1705
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calkr_1705
Enzymes [BR:cki01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calkr_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1771969..1773150)
Genome map
AA seq 393 aa AA seqDB search
MDRYFGRFGGMYAPETLMPALLEIEEEFCKLVKDEKFNQEYEYYLKNYVGRPSPLYFAKN
LSEHLGVKIYLKREDLNHTGAHKINNCIGQALLAKHMGKKRLIAETGAGQHGVATATVAA
LFGMECEIFMGEEDAKRQFHNVQRMKMLGSKVRVVNKGSKTLKDAINEAMRDWSETFEYT
FYLFGTAAGPHPFPTIVKYFQSVIGKETKEQIKSLEGRLPDYVFACVGGGSNAIGIFSAF
LEDHEVKLIGVEGAGEGIHTGKTAATLCSGSVGILHGAKTYILQDEEGQIQNTHSISAGL
DYPGVGPEHAYLKETGRVEYVGATDKEAVDAFLLLTRLEGIIPALESSHALAEVIKRAKM
GLFKSSDIIVVNLSGRGDKDINTVLELWKDDEL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataggtattttggaaggtttggtggaatgtatgcaccagaaactcttatgccagct
cttttagagatagaagaagagttttgcaagcttgtgaaagacgaaaaattcaatcaagag
tatgagtactatctcaaaaactatgttggaagaccatcgccactttactttgccaaaaac
ttgagcgagcatcttggtgttaaaatatatctcaaaagagaagacctaaaccacaccggt
gcccataaaataaacaactgcataggccaggcacttttggcaaagcatatgggcaaaaaa
agacttattgccgagacaggagcaggtcagcacggtgttgcaacagccacagttgctgct
ctttttgggatggaatgcgagatatttatgggtgaagaagatgcaaaaaggcagtttcat
aacgtgcaaaggatgaaaatgcttggcagcaaggtaagagtagttaacaagggaagcaag
acattgaaagacgcaataaacgaggcaatgcgtgactggagcgagacgtttgaatacacc
ttttatctttttggtacagctgcaggacctcatccgttcccaacaattgtaaaatacttt
caaagtgtgattgggaaagagacaaaagagcagataaaaagcttagaaggaagacttcca
gactatgtctttgcgtgtgtgggaggtggttctaacgcaattggcatcttctcagcgttt
ttggaagatcatgaggtaaagcttattggtgttgagggtgcaggagagggaatacataca
ggcaaaacggctgcaacgctatgcagtgggtctgttggaatcttgcatggtgcaaagaca
tatattttacaggatgaggaagggcaaattcaaaacactcattcaatctcagcagggctt
gactacccgggtgttggacctgaacatgcgtatttgaaagaaacaggaagggttgagtat
gtgggggctactgataaagaagctgtggatgcatttttgctgctcacaaggcttgaaggg
ataattccggctttagagagcagccatgcacttgcagaggttattaaaagggcgaagatg
ggacttttcaagagcagtgacattattgttgtgaacctttctggaagaggtgataaggat
ataaatacagtacttgagctttggaaggatgatgagctatga

DBGET integrated database retrieval system