KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1707Help
Entry
Calkr_1707        CDS       T01356                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cki01100  Metabolic pathways
cki01110  Biosynthesis of secondary metabolites
cki01130  Biosynthesis of antibiotics
cki01230  Biosynthesis of amino acids
Module
cki_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calkr_1707
Enzymes [BR:cki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Calkr_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh NMO ThiG QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADQ41197
UniProt: E4SAH2
Position
complement(1773754..1774536)
Genome map
AA seq 260 aa AA seqDB search
MSVLERILSYKKEEVERCKNLIPVEKMKKLAVEKIKGGYLENKFKRIFKKDKFCIIGEIK
RASPSEGVISEDANAKAIAKMYEDLGFFAISVLTERFFFKGSEQDLMEVKKVVSLPVLRK
DFIIDIWQLYQTKMIGADAALLITKALSEKQLTVFIKILEILDIVPLVEVENEYEIEKAL
KCGAKLIGINNRNLDDLSIDITKTERLLKYIPKEVAVISESGIKTKEDFDYILSLGVDGC
LIGTSFMKSQNPLEIIGDRI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcttgagcgtattttaagttataaaaaggaagaagttgaaaggtgcaaaaat
cttatacctgttgagaagatgaaaaaactcgcagttgagaagattaaaggtggctattta
gaaaacaagttcaaaagaatattcaaaaaagataaattctgtataattggtgaaataaaa
agggcatcaccttcggagggtgtaatatcagaggatgccaatgcaaaagcaatagcaaag
atgtatgaagatttagggttttttgccatatcagttttgacagaaaggttttttttcaag
ggttcggaacaagatttgatggaagtaaaaaaagtggtatctctgccagtgctaagaaaa
gactttatcattgatatctggcagctttaccagacaaagatgataggtgcagacgcagct
ttgcttatcacaaaagctttatcagaaaaacagcttacagtattcatcaaaattttggaa
attcttgacatagtgccgcttgttgaggttgaaaatgaatatgaaattgaaaaagctttg
aagtgtggtgcaaaactcataggaatcaataacagaaacctggatgatttgtccatcgac
ataacaaagacagaaaggcttttgaagtatattccaaaagaagttgctgtgataagcgaa
agtggaattaagacaaaagaggattttgactatatactttcgcttggtgttgatggatgt
ttgatagggacatctttcatgaaatcacaaaatcctcttgaaataattggtgatagaata
tga

DBGET integrated database retrieval system