KEGG   Caldicellulosiruptor kristjanssonii: Calkr_1723Help
Entry
Calkr_1723        CDS       T01356                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00010  Glycolysis / Gluconeogenesis
cki00020  Citrate cycle (TCA cycle)
cki00620  Pyruvate metabolism
cki00633  Nitrotoluene degradation
cki00640  Propanoate metabolism
cki00650  Butanoate metabolism
cki00680  Methane metabolism
cki01100  Metabolic pathways
cki01120  Microbial metabolism in diverse environments
cki01130  Biosynthesis of antibiotics
cki01200  Carbon metabolism
Module
cki_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkr_1723
   00020 Citrate cycle (TCA cycle)
    Calkr_1723
   00620 Pyruvate metabolism
    Calkr_1723
   00640 Propanoate metabolism
    Calkr_1723
   00650 Butanoate metabolism
    Calkr_1723
  Energy metabolism
   00680 Methane metabolism
    Calkr_1723
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calkr_1723
Enzymes [BR:cki01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calkr_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_6 Fer4_16 Fer4_7 Fer4_9 Fer4_21 Fer4_2 Fer4_17 Fer4_10 Fer4_4 Fer4_8 Fer4_22 Fer4_3 Fer4_13 Phage_TAC_9
Motif
Other DBs
NCBI-ProteinID: ADQ41212
UniProt: E4SAI7
Position
complement(1792478..1793497)
Genome map
AA seq 339 aa AA seqDB search
MLPTTNELGYYEIRLESIGGLGANVAGKILAEAGVVGSGLNALNFASYGSEKKGSPVKSY
IRFAPKKKQIRINSPVVQPHLVAIFHENMVNTNPVTQGLRKDGIVILNTSKSVDEARDFL
KLASGTVATVDAIRIALEVKTRINMVMLGAIVRMLGFISLDSVKEIVKQTFEKKYPQTIA
SNMAGLEAGYNQVESKFFEYDGKYQYVEYQEERRPMGYKNAPIGGTIVEYANTITKNNIT
SRIGKIPVFIKEKCINCGLCETTCPDYVFVWDRRIENGKLKMFNLGPDYQYCKGCLRCVD
ICPTGALVEGIEREYDIEKISAKHDFDIYEKWYEDGEKR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttaccaactacaaacgaacttggatactacgaaattcgacttgaaagtattggcgga
cttggtgcaaatgttgcgggcaagattttggctgaggcaggtgttgttggaagtggacta
aatgccttaaattttgcaagttatggctctgaaaagaaaggttcgcctgtaaagtcgtat
ataagatttgctccaaagaaaaagcagataagaattaattcgcctgttgttcagcctcat
ctggttgctatattccacgaaaatatggtaaatacaaaccccgtcacacaaggacttaga
aaagatggaatagttatcctgaacacaagcaagagcgtggatgaggctcgagacttttta
aaacttgcaagtggcacggtggcaacagtggatgcaataaggattgcccttgaagttaaa
acaaggattaacatggttatgcttggggcaattgtaagaatgcttgggtttatcagctta
gatagcgtgaaagagattgttaaacaaacttttgagaaaaaatatccacagacaattgcg
tccaacatggcaggtcttgaagctggatataaccaggtagaatctaagttttttgaatat
gatggtaaataccagtatgtggagtaccaggaagaaagaagacctatgggatataaaaac
gctccgattggaggaactattgtagaatatgcaaacacaataacaaaaaacaatataacc
agcaggattgggaaaattcctgtgtttataaaagaaaaatgcatcaactgtgggctttgt
gaaacaacatgccctgattatgtctttgtttgggatagaaggattgaaaatggtaagtta
aagatgtttaatctgggacctgattatcaatattgtaaaggatgcctaagatgtgttgat
atttgtcctacaggtgcacttgttgaaggaattgaaagggaatatgacatagaaaaaatc
tctgcaaaacatgattttgatatatatgaaaaatggtatgaggatggtgagaagagatga

DBGET integrated database retrieval system