KEGG   Caldicellulosiruptor kristjanssonii: Calkr_2038Help
Entry
Calkr_2038        CDS       T01356                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Calkr_2038
Enzymes [BR:cki01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Calkr_2038
Exosome [BR:cki04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calkr_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2110533..2112497
Genome map
AA seq 654 aa AA seqDB search
MIKKVKSTIYLSDIKKFESGEHFESYKFLGSRVVNYRGKVGTVFCVWAPNAKSVSVVGDF
NNWCGENHKMMRVYGSGFWWLFVEGIGEGELYKYEIIGADGKRVLKADPYAIFSELRPNT
ASIVKNIPDYEWHDQEWMEKRNSTPPYDKPINIYEVHLASWKMKKDGSIEKAGEFYNYRE
LAHMLVDYIKEMNYTHIELLPVLEHPLDMSWGYQPTGYFSLTSRYGSIEDFMYFVDIMHQ
NGIGVIVDWVPAHFCKDEHGLYRFDGTFLYEYEDELLRENYTWGTATFDFSKPQVQSFLI
SSAMFWFDIYHIDGIRVDAVSHIIYMNNNQKNRYGGHENIEGIKFIKKLNKAIFSKYPNV
LMIAEESTAFPLVTYPTYDGGLGFNYKWNMGWMNDTLKYMQKHPNERKHHHNLLTFSIMY
AFSENFILPFSHDEVVHGKKSLLDKMPGDYNQKFANLRLLYGYMYTHPGKKLLFMGGEFG
QFIEWRFYASLDWLLLDYPMHRMLQHYVKSLNRFYLENKALWELDHKMDGFRWIDVHNWQ
QSVISYLRFSKDPDDFLVVICNFGLASYENYKIGVPRKGVYLEVFNSDKAEFGGNNIVNT
EKLKTIDEVWHGYNQCIEFSLPALSCLIFKPVEFFDSKPEKVKDTDNNLLQGGG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagtaaaatctactatttacctatctgacataaaaaaatttgaatcaggt
gagcatttcgaaagttacaagtttttgggaagcagggtagtaaactatagaggcaaagtt
ggaacagttttctgtgtgtgggcaccaaatgctaaaagcgtttctgttgttggagatttt
aataattggtgcggcgaaaatcacaagatgatgagagtttatggcagtggattttggtgg
ctgtttgtagaaggcattggcgaaggagaactttacaaatacgagattattggtgctgat
ggaaaaagggttttaaaagctgacccatatgcaattttctctgagcttcgtcccaacaca
gcatcaattgtcaaaaacatcccggactatgagtggcatgaccaggagtggatggaaaaa
agaaattcaactccaccatatgacaagccaatcaacatttatgaggttcatcttgcatca
tggaagatgaaaaaggatggaagcatagagaaggccggtgagttttacaactaccgtgaa
cttgcacacatgctggtagattacataaaagaaatgaactacacacacatagaacttctg
ccagttttggaacatccgcttgacatgtcctggggttaccagccaacaggttacttttct
cttacatcacgctacggtagtattgaggattttatgtattttgtagatattatgcaccaa
aatggaattggagtaatagttgactgggtaccagctcatttttgcaaagatgagcatgga
ctttataggtttgacggaacgtttttatatgaatatgaagatgagcttttgagagaaaac
tacacgtggggtactgccacatttgacttttcaaagccacaggttcaaagtttcttaatt
tcaagtgcaatgttttggtttgatatatatcacattgatggaataagggtagatgctgtt
tctcacatcatctacatgaacaacaaccagaaaaatagatatggcgggcatgaaaacata
gaaggaattaaatttataaaaaagctcaacaaggcaatattctcaaaatatccaaatgtc
ctgatgattgccgaagagtcaactgcatttcctttggtcacatatccaacatacgatgga
gggcttggttttaactacaaatggaacatgggatggatgaacgacaccttaaagtacatg
caaaaacatcccaacgagagaaaacatcatcacaatcttttgacattttccataatgtac
gcattttctgaaaactttattctgccgttttcacacgacgaggttgttcatggaaaaaaa
tctttgcttgacaaaatgccaggtgattacaaccagaaatttgcaaacttaagacttctt
tatggctatatgtacacacatccgggtaaaaagctccttttcatgggcggtgagtttggt
cagtttattgaatggagattttatgcatcacttgactggttacttttggactaccccatg
caccgcatgcttcagcactatgttaaaagtttaaataggttctatttagaaaacaaagct
ctgtgggagcttgaccataaaatggatggttttagatggatagatgtccacaactggcaa
cagagtgtcatatcatacctgagattttcaaaagaccctgatgattttcttgttgttatt
tgtaactttggccttgcttcatatgaaaattacaaaataggtgtgccaagaaaaggtgta
tatttggaagtatttaacagtgataaagctgaatttggtggtaataatatagtaaacaca
gaaaaacttaaaacaattgatgaagtatggcacggatataaccagtgcatagaatttagt
cttcctgctctttcgtgcttgattttcaaacctgttgagttttttgatagcaagcccgaa
aaggtcaaagatactgacaataacttattacaaggtggtggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system