KEGG   Caldicellulosiruptor kristjanssonii: Calkr_2045Help
Entry
Calkr_2045        CDS       T01356                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00010  Glycolysis / Gluconeogenesis
cki00052  Galactose metabolism
cki00500  Starch and sucrose metabolism
cki00520  Amino sugar and nucleotide sugar metabolism
cki01100  Metabolic pathways
cki01110  Biosynthesis of secondary metabolites
cki01120  Microbial metabolism in diverse environments
cki01130  Biosynthesis of antibiotics
cki01200  Carbon metabolism
Module
cki_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkr_2045
   00052 Galactose metabolism
    Calkr_2045
   00500 Starch and sucrose metabolism
    Calkr_2045
   00520 Amino sugar and nucleotide sugar metabolism
    Calkr_2045
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calkr_2045
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Calkr_2045
Enzymes [BR:cki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Calkr_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ADQ41517
UniProt: E4S583
Position
complement(2120374..2121324)
Genome map
AA seq 316 aa AA seqDB search
MYYIGIDLGGTNIAAGIVDEEGKIIKKGSVPTGAHRHYTEIMKDMAELSLNLVKECGLSL
DHIHSVGIGSPGTPDNEKGMILYSNNIAFLNVPMREEIQKYIPKPVNIENDANCAAYGEY
IAGGAKGTKISVTITLGTGIGGGIIIDGKIYTGAHHAGAELGHMVICVDGEQCTCGRKGC
WEAYASATALIRMTREAAARNINGTIMKLVNGDISKIDAKTAFDAKRMGDSEGAAIVDKY
VKYLAEGLVNVCNIFEPEVICIGGGVSKEGEYLLGPVRELVYEKFYCKQISPPKIIPAVL
GNDAGIIGAALLAKQI
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgtattacatagggattgacttgggaggaacaaacattgcagcaggaattgtggatgaa
gaaggaaagattataaaaaaaggttctgttccaacaggtgcgcacaggcactacacagag
attatgaaagatatggcagagcttagcctcaatcttgtaaaagaatgcggactttcttta
gaccacattcactcagttggtattggaagccccggtacgcctgacaatgaaaagggcatg
attctttacagcaacaatattgcgtttttgaatgtgcctatgagagaagagatacaaaaa
tatattccaaagcctgtaaacatagaaaacgatgcaaactgtgcagcgtatggtgagtat
atagcaggcggtgcaaaaggcacaaagatttctgttacaatcacattggggactggcatt
ggcggtggaattataattgatggcaaaatatacaccggggcacatcatgcaggtgctgag
cttgggcatatggtgatttgtgttgatggtgagcagtgcacatgtggccgaaaagggtgc
tgggaagcgtatgcgtcagcaacagctcttattcgcatgacaagagaggctgctgcaaga
aatataaacggcacgattatgaaacttgtaaatggcgacatttctaagattgatgctaag
actgcctttgatgcaaagcgaatgggagacagcgaaggtgcagcaattgttgataagtat
gtaaaatatttagcagaagggcttgtaaatgtttgcaatatattcgaaccagaagtaatt
tgcattggcgggggagtcagcaaagaaggggaatacctgcttggaccggtaagagagctt
gtttatgaaaagttctattgcaaacaaatatcaccacctaaaataattcctgctgtctta
ggtaatgatgcaggtataattggtgctgcacttttggcaaagcagatttaa

DBGET integrated database retrieval system