KEGG   Caldicellulosiruptor kristjanssonii: Calkr_2256Help
Entry
Calkr_2256        CDS       T01356                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cki00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calkr_2256
Enzymes [BR:cki01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Calkr_2256
Amino acid related enzymes [BR:cki01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Calkr_2256
Transfer RNA biogenesis [BR:cki03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Calkr_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2321114..2322571)
Genome map
AA seq 485 aa AA seqDB search
MEVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIES
LRWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEGQRQEL
LSKGQMPRYLGKCRNLTEEQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGDVEFMSDDI
GDFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHV
SLILGKDRTKMSKRHGSTWVEQYKEQGYLKEGLINFLALLGWSPPEDKEIFDMEYLIKNF
SLDRVSKNPAIFDIDKLNYINSQHIKLKSLDELTQMCIPYFVEAGYIKEDEAQSKFEWLK
KIVKSVYEGLDYLSQIKDRVDIFFNNEVKIEDDEAKEVLKWEHVKDLINVFENKITQLND
LSSENIKALFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKENILKRLEFF
KTWYN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtgagaacaaggtttgcaccaagtccgacagggcacctgcacattggaggtgca
agaacagcacttttcaactacctttttgccaaaagatatggtggaaagttcatattaaga
atagaagatacagacttagaaagatcgtctattgagtctgaaaaggttatcatcgaaagt
ttaagatggcttgggattgagtgggacgaaggagttgaggtaggaggtccctatgggcct
tatagatcaacagaaagagtagatatttacaaaaagtatgttgatgttctttttgaaaaa
ggctacgcatactattgttactgcacagaagaggagttagaaggccaaaggcaggagctt
ctctcaaaagggcagatgccaagatatcttggtaagtgcaggaatttaacagaggagcaa
aaaagaagatttgagcaggaggggagaaaaccaactgtcaggttcaaagtgccagaaggt
gttaagatagttgtccatgaccttgtgcgtggagatgttgagtttatgtcagatgacata
ggcgactttgtgattgtcaagtctgatggtattccaacatacaactttgcagttgtcata
gatgaccacttaatgaagatttcgcatgttataagaggagaagagcatctttcaaacact
ccgcgccagattctgatatacaatgcgcttgggtttgaacttccgcagtttgctcatgtt
tcgcttatacttggaaaagacagaacaaagatgtcaaagcgccacggttctacttgggtt
gaacagtacaaagaacaagggtacttaaaagaagggcttataaacttcttggctctgctt
ggctggtcacccccagaggacaaagaaatatttgatatggaatatctaattaagaatttt
tcattagacagagtctctaaaaaccctgcaatatttgacatcgataagctaaactatata
aactctcagcacattaagctaaaatcattggatgaactgactcaaatgtgcataccatac
ttcgttgaagcaggatatatcaaagaagatgaggcgcagtccaaatttgaatggctcaag
aagatagtaaaatctgtgtatgaaggactggattatctttctcagataaaggacagggtt
gatatcttctttaacaatgaagtcaaaatagaggatgatgaggcaaaagaggtcctaaaa
tgggagcatgtgaaagatttaattaatgtctttgagaataagataactcagttaaatgac
ttgagttctgaaaacatcaaagcacttttcaaggagattcaaaaagagactggctataaa
ggcaaaaacctatttatgccgataagagttgtgttgactggcaaaactcacggacctgag
cttgttgagataattgagattgtggggaaagaaaacatactaaaacgattggaattcttc
aaaacgtggtataattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system