KEGG   Caldicellulosiruptor kristjanssonii: Calkr_2565Help
Entry
Calkr_2565        CDS       T01356                                 

Definition
helicase, recd/traa family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cki00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calkr_2565
Enzymes [BR:cki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Calkr_2565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2713922..2716147)
Genome map
AA seq 741 aa AA seqDB search
MQQNIQGMVSDIIYRNLENSYTVFEIICDDEVFTAVGIVPDIAIGEKVSVYGEFYVHPVY
GQQLKVSYLEKLLPQTKDEIYLYLSSGVIKGIGQKTAKKIVDTFGDDTARVLQEEPEKLL
QIRGMTPEKVERIRNMFAFQKFLKDIMSIFSQYGLSQNHAMRLFKLYGFSALSLLQENPY
FLLDVFPELDFKKVDRLALDMGVMPDDRRRISAKILNLLTLAANNEGHTCLPENRLKQLC
SKTLDLPVEKIEEALEALEVERRVVKDEVDSQDMVFLYGYYECERYIADKILSMLKEYDD
IADIDEKISMFEERNGIAFSPNQKKAIKMALTQGVSIITGGPGTGKTTIIKCIIQIFEGE
GKKVFLCAPTGRAAKRMQAACERESKTIHRLLEMTVLDTHVIFQKGPSNPLKCDVIIVDE
MSMVDSFLMNYLLAATKPSTRIVLVGDKDQLPSVGAGNVLKDLIKSEIVPCTTLTEVYRQ
SENSFIVLNAHRINRGEYPHLQKESDFYFIQKNSQEEILKTVVELVTKKLPNYLSCDPMT
DIQVLCPSKKGIVGMYNLNRVLQQHLNPPHPSKKEYAYKENLFRVGDKVMQIKNNYSLEY
EIVQGEEKGRGSTGIFNGDIGVVKDIDRAQGALEILFDDEKLVYYDFSLLDDLELAYAMT
VHKSQGSEFRCIVMPVVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSGLCDFLLRGQSNTQLQAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacatacagggtatggtgagcgatataatctacaggaatttggagaatagc
tatactgtgtttgagataatctgcgacgatgaggtgttcacggcagtaggaatagttccg
gacattgccatcggcgaaaaggtgagcgtttacggtgagttttatgttcatcctgtttat
ggtcagcagctgaaagtaagctaccttgaaaagcttttgccacagacaaaggatgagata
tatctttatctttcctctggagtgataaaaggtatcgggcagaagactgcaaagaagatt
gttgatacctttggggacgacactgcaagagtgctgcaagaagagcctgaaaagcttttg
cagattcgcggcatgacacccgaaaaggttgagcgaataagaaacatgtttgcattccag
aaatttttgaaagacatcatgtcaatcttttcccagtacggactttcacagaaccatgca
atgagactttttaaactttatggattttctgctctgtcgcttttgcaggaaaatccatat
tttcttttggacgtgttcccagaacttgactttaaaaaggttgacaggcttgcacttgac
atgggagttatgccggatgacagaagaagaatatctgctaagatactcaacctcttaact
ctggctgcaaacaacgaggggcacacctgcctgccagaaaatagactcaaacagctttgt
tcaaaaacccttgaccttccagtggaaaaaatagaagaggcacttgaagctttagaggta
gaaagaagagttgtgaaggatgaagttgactctcaagatatggtatttttgtacggctac
tatgaatgcgaaaggtatatagcagataaaatcctttcaatgctaaaagagtatgatgac
attgccgatatagatgaaaaaatttcaatgtttgaagagagaaacggcattgcattttca
ccaaatcagaaaaaagccatcaagatggcgctaactcaaggtgttagcatcatcacaggc
ggaccgggaactggtaagaccacaatcataaagtgcatcattcagattttcgagggtgaa
ggcaaaaaggtttttctttgcgcaccaaccggaagggctgcaaagaggatgcaggcagcc
tgcgaaagagaatcaaagacaatccacagacttttggaaatgacagttttggacacacat
gttattttccagaaaggaccaagcaatcctttaaaatgcgatgtcatcattgttgatgag
atgagcatggtagacagtttccttatgaactatcttcttgctgcaacaaagccgtcaacc
agaattgtgcttgttggagacaaagaccagcttccatcagttggtgcaggaaatgtcttg
aaagaccttataaaaagcgaaattgttccctgcactactttgacagaggtgtaccgccag
agcgaaaatagttttatagtcctcaacgctcacagaataaatagaggtgagtatccacac
cttcaaaaagagagcgatttttattttatccagaaaaactctcaggaagagattttgaaa
actgtggttgagcttgtgaccaaaaaacttccaaactatctttcgtgcgacccgatgaca
gacatccaggtcctgtgcccttccaaaaagggaattgttgggatgtacaacctaaaccgc
gtgctgcagcagcatctcaacccacctcatccatctaaaaaagagtatgcttataaagaa
aacctgttcagggttggagacaaggtcatgcagataaaaaacaactattcgctggaatat
gagattgtacaaggagaggagaagggcaggggctcaacagggatattcaatggcgatatc
ggagttgtcaaagacatcgacagggcgcaaggtgcgctggagattttgtttgacgatgaa
aagcttgtgtattatgacttttctctgcttgacgacctggagcttgcatatgccatgact
gttcacaaatcacaagggtctgaattcaggtgcatagtgatgcctgttgttgagacctac
cctattttgatgacaagaaaccttctgtatacggcagttacgcgtgcaaaagagcttgtt
gtgctggtgggcaaaaaaagtgcgcttgagtacatgattgcaaaccaaaaagaggctatg
cgatattcaggactttgcgactttttattgcgcgggcaatcaaatacgcaattgcaagct
ttatga

DBGET integrated database retrieval system