KEGG   Clostridium kluyveri DSM 555: CKL_0509Help
Entry
CKL_0509          CDS       T00564                                 

Definition
D-cysteine desulfhydrase (EC:3.5.-.-)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CKL_0509
Enzymes [BR:ckl01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     CKL_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481333..482322
Genome map
AA seq 329 aa AA seqDB search
MIKIPERMNMANLPTKIEKMERLSQKLGGPDIYIKRDDQTGTEISGNKIRKLEFSAAEAL
NKGCNTLITCGGIQSNHCRATAAVAVKLGFKCCLVLNGSNDTEVDGNLLLDKLLGAEIYF
VSQKEYENRRMEIMKEIKTNMENKGLKPYIIPEGASNGIGGFGYYKAVQEIMLQEREMKV
HFDGIVIATGSGGTYSGLLLGSRILNYDAKIYGVNVCQNEKYFKDRIYEILHDSMKYIDV
NLNFSKDEINIIDGYVGRGYALSREEELEFIKELAELEGIILDPVYTGKAMYGLTQEIKK
GKFSKYKNLLFIHTGGIFGIFPQKSQFRV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattccagaaagaatgaacatggctaatttgccaactaaaatagagaaaatg
gagagactatcccaaaaactaggtggaccagatatatatataaagcgggatgatcagaca
ggaacagagatctctggaaataagataagaaagttagaattttctgcagcagaagctttg
aataaaggatgtaatacattaattacttgtggtggaattcagtcgaatcattgtagggct
actgcagcagtggctgtaaagctcggttttaagtgttgtctggttctaaatggcagtaat
gatacagaagtcgatggaaaccttttactggataagcttttaggagctgaaatttatttt
gtttctcaaaaagaatatgaaaatagaagaatggaaattatgaaagaaattaaaaccaat
atggaaaataaggggctgaaaccttatattattccagagggtgcatcaaatggaatagga
ggttttggttattataaagctgtacaggaaataatgctccaagaaagagaaatgaaagta
cattttgatggaattgttattgctacaggttccgggggaacctattcaggactgttatta
ggcagcagaatattaaattatgatgctaaaatttatggagttaatgtatgtcagaatgag
aaatattttaaggacaggatttatgaaatattgcatgatagcatgaaatatattgatgtg
aaccttaatttttcaaaggatgaaataaatatcatagatggatatgtaggcagaggatat
gctttgagccgtgaagaggaactggaatttattaaggaacttgcagagttagaagggata
atattggatcctgtatatacaggtaaagcaatgtatggattgacccaggaaattaaaaaa
gggaaattcagtaaatataaaaatttattatttatccatactggaggaatatttggaata
tttcctcaaaaatctcagtttagagtttaa

DBGET integrated database retrieval system