KEGG   Clostridium kluyveri DSM 555: CKL_0704Help
Entry
CKL_0704          CDS       T00564                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKL_0704 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKL_0704 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CKL_0704 (thrC)
Enzymes [BR:ckl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CKL_0704 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689831..691321
Genome map
AA seq 496 aa AA seqDB search
MKEIYYNSTRGLNKNFTASRAILNGISEDGGLFIPHTIPFIDEEELKKLKYMTYKELALC
IIEKFFTDFSKEELKECIDLAYDNKFESDKIVPLEKVGDVFYLELFHGPTLAFKDMALCL
LPHLMKTAAKKQKLHKEIVILTATSGDTGKAALEGFANVEGTKIVVFFPEQGVSKIQKKQ
MVTQQGGNTKVVGIEGNFDDAQSEVKKIFNDHELKEELNENSYRFSSANSINIGRLIPQV
VYYFYGYMELLRRGEINFGNKINFSVPTGNFGNILAAYYAKKMGLPINKLICASNENRVL
YDFFENGTYDAEREFILTISPSMDILISSNLERLIYDISGKDSTVVNKLMTNLSEHSKYT
VSESMKEELKVFYGGFASEEETLKCIKETFDTYQYLMDTHTSVAYSVYKNYLRDTCDDTK
TIVVSTASPFKFTKSVMSALDTKYSYQEDLELVEVMSKIASLEIPAPIRKLEDSKVVHNT
VCKREEMKEEIRKFLL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggagatttattataatagtaccagaggtctaaataaaaattttactgcatccagg
gcaatattaaatggaatatccgaggatgggggattatttattccgcacaccatacctttt
atagatgaagaggaattaaaaaaacttaagtatatgacttataaggaattggccttgtgt
ataattgaaaaattctttacagactttagcaaagaagaattaaaagaatgtatagattta
gcctatgataataaatttgaatcagataaaatagttcctttggaaaaagtgggagatgta
ttctatcttgaactatttcatggtcccactttagcttttaaggacatggcattatgcctt
ctaccacatttgatgaagactgctgctaaaaaacagaagttacataaagaaatagtaata
cttacagctacatccggagatacaggaaaggctgctttggagggttttgcaaatgtagaa
gggactaaaatagtagtattcttcccggaacagggagtaagcaagattcaaaaaaaacag
atggtgacccaacaggggggaaatacaaaagtagtaggtatagaaggaaactttgatgat
gcccaaagcgaagtaaagaaaattttcaatgatcatgaattaaaggaagaactaaatgaa
aattcctacagattttcttctgccaattccataaacataggaagactcattcctcaggta
gtttattatttttatggatatatggaacttttgagaagaggagaaataaactttgggaac
aaaataaatttttctgttcctacaggaaactttgggaatatacttgcggcttattatgct
aaaaagatgggacttccaattaacaagctcatatgcgcatcaaatgaaaatagggtactt
tacgatttctttgaaaatggaacctatgatgcagaaagagaatttattttaactatatct
ccttccatggatatacttatatcaagcaatcttgagagacttatatatgatataagcggc
aaggattccacggttgtgaacaaactgatgacaaatttaagtgaacacagtaagtataca
gttagtgaaagcatgaaagaggaattgaaggtattttacggaggatttgcaagcgaagaa
gaaactttgaagtgcataaaagaaacttttgatacatatcagtatcttatggatactcat
acctctgtagcctattctgtctataaaaattacttgagggatacttgtgatgatacaaaa
accatagtggtttcaacagcaagtccatttaagttcaccaaatctgtaatgagtgctttg
gacactaaatatagctaccaggaagatctggaacttgtagaagttatgagtaaaattgca
tcacttgaaattccagcacctataagaaaattggaagatagtaaagttgttcataatact
gtgtgtaaaagggaagagatgaaggaagaaattagaaaatttttattgtag

DBGET integrated database retrieval system