KEGG   Clostridium kluyveri DSM 555: CKL_0713Help
Entry
CKL_0713          CDS       T00564                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKL_0713 (hemB)
Enzymes [BR:ckl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CKL_0713 (hemB)
Exosome [BR:ckl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKL_0713 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707005..707973
Genome map
AA seq 322 aa AA seqDB search
MFKRYRRLRKNYAIRSMVRETVLNEEDFVYPLFIVEGNNIKKEIKSLPGNFHWSVDRLDE
LVEDIVRAGVKGVIIFGIPNYKDDVGSGAYDDEGIVQKAVREIKRIAPDIWVITDVCMCE
YTSHGHCGIVIDNSVDNDETLKYIAKIALSHAQSGADMVAPSDMMDGRVGAIRSILDENG
YKDVSIMAYSAKYASAFYGPFREAADCCPEFGDRKSYQMDPANSREAMLEIQEDIDEGAD
IVMIKPALPYLDIIKMTRDKFDNPIAAYSVSGEFAMIKAAAALGVIDEKAIVLESLTSIK
RAGADIIITYHAIDVARWIRRD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatatagaagacttaggaaaaattatgcaataaggagtatggtaagggaa
acagtattaaatgaagaagattttgtttatcctttgtttattgtagaaggaaataatata
aagaaagaaataaaatctcttcctggaaattttcattggtctgtggataggcttgacgaa
ttggtggaggatatagtcagagcaggagtaaaaggtgtaatcatttttggaattccaaat
tataaagatgatgtaggcagcggagcctatgatgatgaaggtatagttcaaaaagcagtg
cgtgaaataaagagaattgcaccggatatttgggttattacagatgtttgtatgtgtgaa
tatactagccatggacactgcggcatagtaatagataattctgtagataatgatgaaaca
ttaaagtatatagctaaaatagctctttcccatgcacagtcaggagctgatatggtggca
ccttctgatatgatggatggaagagtaggggcaatcagaagtattttagatgaaaatggc
tacaaagatgtaagtattatggcctatagtgccaagtatgcatctgctttttatggacct
tttagggaagctgcagattgctgccctgaatttggagatagaaagagctatcagatggat
cctgcaaatagcagagaagctatgctggaaattcaggaggatattgatgagggagcggat
atagttatgataaagcctgccctaccttacctggatataataaaaatgacaagagataaa
tttgataatcctatagcggcatatagtgtaagtggagaatttgccatgattaaagctgca
gcagcccttggagttatagatgaaaaagccatagtacttgagagccttacatccattaaa
agagcgggagcagatataataataacttatcatgcaatagacgtagcaaggtggattaga
agagattga

DBGET integrated database retrieval system