KEGG   Clostridium kluyveri DSM 555: CKL_0732Help
Entry
CKL_0732          CDS       T00564                                 

Gene name
cobC2
Definition
protein CobC2 (EC:3.1.3.73)
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKL_0732 (cobC2)
Enzymes [BR:ckl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CKL_0732 (cobC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724283..724864
Genome map
AA seq 193 aa AA seqDB search
MLELILIRHGQTDSNRKGTYSGWTDIELNKCGISQAERVRDKLKHINFDLVVASPLKRAK
KTAEIISKNIIYDEGLKEINFGLWDNLSLEEIEEKYPEEYELWMRDKKEEFIFPQGESIK
DVQERAANVIDNIIKKQKKGIVLIVTHGGLIRNIVAHLLGMGRAGSWRFRIDNCGITKIQ
ITDGYAVLTELNG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttagaattgattttgataagacacggacaaactgacagcaatagaaagggaacatat
tcaggctggacagatatagaacttaataaatgtggaattagtcaggctgagagggtaaga
gataaactaaaacacataaattttgatcttgtagtggctagtccacttaaaagggctaaa
aaaactgctgagattatcagcaaaaatataatttacgatgaaggacttaaggaaattaat
tttgggttatgggacaacctgtctttagaggaaattgaagaaaagtatccagaggagtat
gagttatggatgagagataaaaaagaggaatttatttttccacagggagaaagtataaag
gatgtgcaggaaagggcggcaaatgttattgataatataatcaaaaaacagaaaaagggt
attgttttaattgttacccatggaggcttaataagaaatattgtagcacacttgcttggt
atgggcagggcaggatcctggcgttttcgtatagataattgtggtataactaaaattcag
ataacagatggatatgccgtcttaactgaactaaatggataa

DBGET integrated database retrieval system