KEGG   Clostridium kluyveri DSM 555: CKL_0957Help
Entry
CKL_0957          CDS       T00564                                 

Gene name
folP
Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKL_0957 (folP)
Enzymes [BR:ckl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CKL_0957 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960928..961743
Genome map
AA seq 271 aa AA seqDB search
MSRIMRIGEKDFQIGKRTYIMGILNITPDSFSDGGKFNNIELALERAKQMEIEGADIIDI
GGESTRPGYKPITEQEELERIIPVIGTLVKHINIPISVDTYRSKVAERALDVGASFVNDI
WGLKKDPRMAFIASHYKVPCCLMHNRDNTNYNNLIEDILNDLKESINIALNAGVDDKNII
LDPGIGFGKNYEQNLMVMRNLERFSELGYPVLLGTSRKSIIGNTLKLKVHERLEGTIATT
VIGIMKKCAFVRVHDVKENKRAAVMSDIIVR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaataatgaggataggtgaaaaagattttcaaataggtaaaagaacttatata
atgggtatacttaatattaccccagattctttttcagatggaggaaagtttaataatata
gaattagctttagaacgtgctaaacaaatggaaatagaaggagctgacataatagatata
ggtggagaatctacgagaccgggttataagcctataactgaacaggaagaactagagagg
attattcctgtaatagggacattagtaaaacacataaatatacctatttcggtagataca
tatagatctaaagttgcagaacgagctttagatgtaggagcatcttttgtaaatgatata
tggggacttaaaaaagatcctcgcatggcgtttatcgcatctcattataaggttccgtgt
tgtttaatgcataatagagacaatacaaactataataatttgatagaagatatattgaat
gatttaaaagagagtataaatattgctttaaatgctggagtagatgataaaaatataata
ttagatcctggaattggatttgggaagaactatgaacagaatttaatggttatgcgtaat
ttagaaaggttttctgaactaggttatcctgtgcttcttggaacctcaagaaaatcaatt
ataggaaatacattaaagcttaaagtacatgagcgattggaaggaactatagctaccaca
gtgataggtataatgaaaaaatgtgcttttgtaagagttcatgatgttaaagaaaataaa
agagcagctgtaatgtcagatataatagttagatga

DBGET integrated database retrieval system