KEGG   Clostridium kluyveri DSM 555: CKL_0957Help
Entry
CKL_0957          CDS       T00564                                 

Gene name
folP
Definition
hypothetical protein
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ckl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960928..961743
Genome map
AA seq 271 aa AA seqDB search
MSRIMRIGEKDFQIGKRTYIMGILNITPDSFSDGGKFNNIELALERAKQMEIEGADIIDI
GGESTRPGYKPITEQEELERIIPVIGTLVKHINIPISVDTYRSKVAERALDVGASFVNDI
WGLKKDPRMAFIASHYKVPCCLMHNRDNTNYNNLIEDILNDLKESINIALNAGVDDKNII
LDPGIGFGKNYEQNLMVMRNLERFSELGYPVLLGTSRKSIIGNTLKLKVHERLEGTIATT
VIGIMKKCAFVRVHDVKENKRAAVMSDIIVR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaataatgaggataggtgaaaaagattttcaaataggtaaaagaacttatata
atgggtatacttaatattaccccagattctttttcagatggaggaaagtttaataatata
gaattagctttagaacgtgctaaacaaatggaaatagaaggagctgacataatagatata
ggtggagaatctacgagaccgggttataagcctataactgaacaggaagaactagagagg
attattcctgtaatagggacattagtaaaacacataaatatacctatttcggtagataca
tatagatctaaagttgcagaacgagctttagatgtaggagcatcttttgtaaatgatata
tggggacttaaaaaagatcctcgcatggcgtttatcgcatctcattataaggttccgtgt
tgtttaatgcataatagagacaatacaaactataataatttgatagaagatatattgaat
gatttaaaagagagtataaatattgctttaaatgctggagtagatgataaaaatataata
ttagatcctggaattggatttgggaagaactatgaacagaatttaatggttatgcgtaat
ttagaaaggttttctgaactaggttatcctgtgcttcttggaacctcaagaaaatcaatt
ataggaaatacattaaagcttaaagtacatgagcgattggaaggaactatagctaccaca
gtgataggtataatgaaaaaatgtgcttttgtaagagttcatgatgttaaagaaaataaa
agagcagctgtaatgtcagatataatagttagatga

DBGET integrated database retrieval system