KEGG   Clostridium kluyveri DSM 555: CKL_1280Help
Entry
CKL_1280          CDS       T00564                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ckl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ckl00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ckl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1315997..1316788
Genome map
AA seq 263 aa AA seqDB search
MNRIDFKFKELKDQGKKALIPFITAGDPSLDTTVNIVLEMDKKGADIVEIGIPYSDPLAD
GPIIQGSSQRAIKGGAKIRNIMETVRKIRGKSEIPLVYMVYYSSIFKYGLERFIAEASAV
GINGIIIPDLPIEERGDIMDITVKYEVHLIPLVAPTSKRRIQEIAAGGSGFVYCVSKNGV
TGVGEKIKTDIKEYMELVGSYTELPKALGFGISGSSMAREFKPYCDGIIIGSAIIDIIYK
CKGEKEILDKVGNFISEVKKSLE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattgattttaaatttaaagagttaaaagatcaaggtaaaaaagcacttata
ccttttataacagcaggagatcctagtctggatactacagttaatattgtgcttgaaatg
gataaaaaaggagcggatatagtggaaattggaataccctactccgatccactggcagat
gggcctattatacagggttcttctcaaagagcaataaaggggggagccaaaattagaaac
attatggaaactgtaagaaagataaggggaaaaagtgaaattcctcttgtatatatggta
tactacagttctatatttaaatatggtttggaaagatttatagcggaagcttctgctgta
ggaataaatggaattataatcccagatcttcccatagaagaaaggggagacataatggac
ataactgtaaaatatgaagttcacttaatacctcttgtggcacctacctcaaaaagaaga
attcaggaaatagcggctgggggatccggctttgtatattgcgtatctaaaaatggggta
actggagtgggagagaaaatcaaaactgatattaaagaatatatggaacttgtagggagc
tatacggaacttcctaaagctttgggctttggaatttcaggatccagtatggcaagagaa
tttaaaccttattgcgatggaataataatagggagtgccataattgacatcatatataaa
tgtaaaggggaaaaagaaatattagataaagtagggaattttatttcagaggtgaaaaag
agcttggagtag

DBGET integrated database retrieval system