KEGG   Clostridium kluyveri DSM 555: CKL_1365Help
Entry
CKL_1365          CDS       T00564                                 

Definition
(GenBank) Hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00230  Purine metabolism
ckl01100  Metabolic pathways
Module
ckl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CKL_1365
Enzymes [BR:ckl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CKL_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Cytidylate_kin AAA_22 AAA_33 AAA_28 MMR_HSR1 ADK RNA_helicase AAA AAA_14 RsgA_GTPase AAA_16 AAA_17 ABC_tran AAA_24 T2SSE
Motif
Other DBs
NCBI-ProteinID: EDK33407
UniProt: A5N7X6
Position
1404256..1404921
Genome map
AA seq 221 aa AA seqDB search
MKKGLLIVISGPSGTGKGTICKELISKNNFWMSISATTRSPRKGEVDGINYYFFTEEIFK
AKVENKDFLEYAKVYGNYYGTPKSEVLKAIDEGKDVVLEIDIQGALKVKEAYPKGVFIFI
LPPSMEELKNRIIKRGSETPESLMTRFKSAYKEINYVSKYNYAVINDTIECAVRNIESII
AAEKCRVDRIKDEILSSKEGVTYEQLDDKSIYCGFIEKSGE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggggcttttaattgttatatcagggccttctggaactggcaaggggacaata
tgcaaagaattaatcagcaaaaataatttttggatgtccatttcagccactaccagatcc
ccaagaaaaggggaggtggatgggataaactattatttttttactgaagaaatttttaaa
gccaaagtggagaataaagattttttagaatatgcaaaagtatatggaaattattatgga
actcctaaatctgaggttttaaaggctatagatgaaggaaaagatgtggtgcttgaaata
gatattcagggggccttaaaagtaaaggaagcttatcctaaaggagtatttatatttata
cttccaccttcaatggaagaacttaaaaataggattataaaaagaggcagtgaaacgccg
gagtctcttatgaccagatttaaatcagcgtataaggaaatcaattatgtatcaaaatac
aattatgcggttataaacgatactattgaatgtgcagtaagaaatatagaaagcataatt
gctgctgaaaagtgcagagtagatagaattaaagatgaaatattaagttccaaggaggga
gttacttatgaacaactcgatgataaatccatctattgtggatttattgaaaaaagtgga
gaatag

DBGET integrated database retrieval system