KEGG   Clostridium kluyveri DSM 555: CKL_1365Help
Entry
CKL_1365          CDS       T00564                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ckl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1404256..1404921
Genome map
AA seq 221 aa AA seqDB search
MKKGLLIVISGPSGTGKGTICKELISKNNFWMSISATTRSPRKGEVDGINYYFFTEEIFK
AKVENKDFLEYAKVYGNYYGTPKSEVLKAIDEGKDVVLEIDIQGALKVKEAYPKGVFIFI
LPPSMEELKNRIIKRGSETPESLMTRFKSAYKEINYVSKYNYAVINDTIECAVRNIESII
AAEKCRVDRIKDEILSSKEGVTYEQLDDKSIYCGFIEKSGE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggggcttttaattgttatatcagggccttctggaactggcaaggggacaata
tgcaaagaattaatcagcaaaaataatttttggatgtccatttcagccactaccagatcc
ccaagaaaaggggaggtggatgggataaactattatttttttactgaagaaatttttaaa
gccaaagtggagaataaagattttttagaatatgcaaaagtatatggaaattattatgga
actcctaaatctgaggttttaaaggctatagatgaaggaaaagatgtggtgcttgaaata
gatattcagggggccttaaaagtaaaggaagcttatcctaaaggagtatttatatttata
cttccaccttcaatggaagaacttaaaaataggattataaaaagaggcagtgaaacgccg
gagtctcttatgaccagatttaaatcagcgtataaggaaatcaattatgtatcaaaatac
aattatgcggttataaacgatactattgaatgtgcagtaagaaatatagaaagcataatt
gctgctgaaaagtgcagagtagatagaattaaagatgaaatattaagttccaaggaggga
gttacttatgaacaactcgatgataaatccatctattgtggatttattgaaaaaagtgga
gaatag

DBGET integrated database retrieval system