KEGG   Clostridium kluyveri DSM 555: CKL_1597Help
Entry
CKL_1597          CDS       T00564                                 

Definition
transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKL_1597
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_1597
   00052 Galactose metabolism
    CKL_1597
   00500 Starch and sucrose metabolism
    CKL_1597
   00520 Amino sugar and nucleotide sugar metabolism
    CKL_1597
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CKL_1597
   00524 Butirosin and neomycin biosynthesis
    CKL_1597
Enzymes [BR:ckl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CKL_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1672396..1673349)
Genome map
AA seq 317 aa AA seqDB search
MEEKYVIGVDLGGTKIAAALVDFKGTIICKYTLPTKAEEGEKYILDNIIKIIEKVVNFGG
VCSKKIKCIGLGAPGPLDIDKGKIICTPNLPFKNFNIVSPLKNHFKMPIFLDNDGNAAAI
AEHMFGAGKGINNMVFITVSTGIGGGAILNGQIYRGNTKNALEIGHMTLDAQGPLCNCGN
FGCAEVMASGTAIAREAKKAVKMGYNTTLALYKNITSKEVFKEAQLGDSISQNILDTTLN
YLGICVANIITCLDPEAVIIGGGVSKGGKIIFDKINEVVKRRCFGTVSKNTRILPALLGT
DAGVIGAAALAFIEEKF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaaaatatgtaataggagttgatttagggggcactaaaatagctgctgcttta
gtggattttaaaggaacaataatatgtaaatataccttgcctacaaaagcagaagaagga
gaaaaatatatattagataatataataaaaatcatagaaaaagtagtgaactttggcgga
gtttgcagtaaaaaaataaaatgtattggattaggagctccgggtcctcttgatatagac
aaaggaaaaattatatgtactccaaacctgccctttaaaaattttaatattgtaagcccc
ttgaaaaatcattttaagatgcccatatttttagataatgatggtaatgctgcggctata
gccgaacacatgttcggtgcaggaaaaggaattaataatatggtgtttataactgtttct
acggggataggaggaggagcaatattaaatggacagatatataggggtaataccaaaaat
gctctggaaataggacatatgaccttagatgcacagggtccgctttgcaattgtggtaat
tttggatgcgcagaagtaatggcttcaggaacagctatagctagagaagcaaaaaaagca
gtaaagatgggatataataccacccttgcattatataaaaatataacttcaaaagaggtc
tttaaagaagctcaattaggagatagtatatcacaaaatatactagatacaactttaaat
tatttgggtatatgtgtagcgaatataattacttgtttagatccggaagctgtgattata
ggtggaggagtctcaaaagggggaaaaatcatctttgataaaataaatgaagtagtgaaa
aggagatgctttggtacagtaagtaaaaatacaaggatacttcctgcacttttgggaaca
gatgcaggcgttataggagccgcagcacttgcatttatagaagaaaaattttag

DBGET integrated database retrieval system