KEGG   Clostridium kluyveri DSM 555: CKL_1614Help
Entry
CKL_1614          CDS       T00564                                 

Gene name
aad
Definition
(GenBank) Aad
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00010  Glycolysis / Gluconeogenesis
ckl00071  Fatty acid degradation
ckl00350  Tyrosine metabolism
ckl00620  Pyruvate metabolism
ckl00625  Chloroalkane and chloroalkene degradation
ckl00626  Naphthalene degradation
ckl00650  Butanoate metabolism
ckl01100  Metabolic pathways
ckl01110  Biosynthesis of secondary metabolites
ckl01120  Microbial metabolism in diverse environments
ckl01130  Biosynthesis of antibiotics
ckl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_1614 (aad)
   00620 Pyruvate metabolism
    CKL_1614 (aad)
   00650 Butanoate metabolism
    CKL_1614 (aad)
  Lipid metabolism
   00071 Fatty acid degradation
    CKL_1614 (aad)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CKL_1614 (aad)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKL_1614 (aad)
   00626 Naphthalene degradation
    CKL_1614 (aad)
Enzymes [BR:ckl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CKL_1614 (aad)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CKL_1614 (aad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: EDK33656
UniProt: A5N8M5
Position
1688323..1690953
Genome map
AA seq 876 aa AA seqDB search
MKVTNVEELMKKLQKVRQAQEKFSTYTQEQVDEIFKQAAMAANSARIKLAKMAVEETGMG
IVEDKVIKNHFVSEYVYNKYKDEQTCGVLERDEGFGMVRIAEPVGVIAAVVPTTNPTSTA
IFKALIALKTRNGIVFSPHPRAKRSTVAAAKIVLDAAVEAGAPVEIIGWIDEPSIELSQL
VMKEADLILATGGPGMVRAAYSSGKPAIGVGPGNTPVIIDDSANIKMAVNSILLSKSFDH
GVICASEQSVMVLDRIYEEVKTEFSERGGYILKNDEIDKVRETILVNGSISPDIVGQSAR
KIAEMAGVKVPERTKILIGEVESVELEEPFSREKLSPVLAMYRVKNFNDGLKKAARLVEL
GGIGHTSVLYVNTMTQKEKVEKFSEAMKTGRTLINMPSAQGAIGDLYNFKLAPSLTLGCG
SWGGNSISENVGPKHLLNIKSIAERRENMLWFRVPEKIYFKYGALGTALKELKTMHKKKV
FIVTDKVLYQLGYTDSITKILGEMGVGYKIFTDVEPDPTLATAKKGSAEMLQYNPDTIIS
VGGGSAMDAAKIMWVMYEHPEIKFEDLAMRFMDIRKRVYTFPKMGEKSMMISVATSAGTG
SEVTPFTVITDEKTGAKYPLADYELTPDIAIIDAELMMNMPKGLTAASGIDAMTHALESY
VSVMASEYTNGLALEAIRLIFKYLPLAYAEGTTNVKAREKMAHASTMAGMAFANAFLGVC
HSMAHKLGAAHHIPHGIANALMIDEVIKFNAVNDPRKQAIFPQYKYPNAKWRYARIADYL
ELGGNSEDEKVGLLIKAIDELKEKINIPKTIREAGVAEKKFYATLDDMSEQAFDDQCTGA
NPRYPLISEIKQMYINAFDKVSPVVDEEEKLKVSLL
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttacaaatgttgaggaattaatgaaaaaattacaaaaggtaagacaggcacag
gagaaattttccacttatacccaggaacaggtagatgagattttcaaacaggcagctatg
gcagccaatagtgccagaataaaacttgctaaaatggctgtggaagaaactggcatggga
attgtggaagataaggtcatcaaaaatcattttgtttcagaatatgtgtacaacaaatat
aaggatgaacagacctgcggggtcttagaaagagatgaaggctttggtatggttagaatt
gcagaacctgtaggtgttattgcagcagttgtgcccactacaaatcccacctctacagca
atattcaaagctctaatagctcttaaaacccgaaatggcatagttttttcacctcatcct
agagctaaaagatcaactgttgcggcagcaaaaatagtccttgatgctgcagttgaggca
ggggcaccggtggaaattataggatggatagatgaaccctcaattgaactttctcagtta
gtaatgaaggaggcggatttaattcttgctacaggcggaccaggaatggttagggcagct
tattcatcgggaaaacctgccataggagttggtcctggaaacacccctgttataattgat
gacagtgcaaatattaaaatggcagtaaactctatacttctttcaaaaagctttgatcat
ggtgtgatatgtgcctcggagcagtcagtaatggtactggatagaatatatgaggaagta
aaaacagaattttcagaaagagggggatatatactgaaaaatgatgaaatagataaggtc
agagagactattttagttaatggaagcataagtcctgatattgttggacagagtgctcgt
aaaatagcagagatggcaggagtgaaagtgcctgagagaacaaagatactcataggtgaa
gtagagtctgtagaacttgaagaaccattctctcgtgaaaaattatctccggttcttgcc
atgtacagagttaaaaatttcaatgatggtctgaaaaaagcagcaagactggttgaattg
ggaggcatagggcatacttctgtgctttatgtaaatactatgacccaaaaagaaaaagtg
gaaaagttcagtgaagctatgaagacaggcagaacccttataaatatgccatcagcacag
ggagctataggagatctatataattttaaactggctccttcattgacccttggctgcggt
tcctggggaggaaactccatatcagaaaatgtgggaccaaaacatttgttgaatataaag
agtattgcggagaggagagaaaacatgctttggtttagggttcctgaaaaaatttatttt
aaatacggtgcacttggaactgccctaaaagaactaaagactatgcataagaagaaggtc
ttcatagtaacagataaggttctttatcaattaggatatacagatagtattacaaaaatt
cttggagaaatgggagtaggctataaaatatttacagatgtggaacctgatccaaccctt
gctacagctaaaaaaggttcagcagaaatgcttcaatataatccagatactattatatca
gttggaggcggctccgcaatggacgctgcaaaaatcatgtgggttatgtacgaacatcct
gaaataaaatttgaagacctggccatgagatttatggatataagaaagagagtttataca
ttccctaagatgggcgaaaaatccatgatgatttcggtggccacatctgcaggaacggga
tcagaagttactccgtttacagtaattactgatgaaaaaacaggagccaaataccctctg
gcggattatgaattaacaccagatatagctataattgatgcagagcttatgatgaatatg
ccaaagggactaactgcagcatcgggtatagatgcaatgacccatgccctggagtcttat
gtatctgtaatggcttcagaatataccaatgggttggcacttgaagcaataagattgata
tttaagtatttaccgctagcttatgcggaaggaaccactaatgtaaaagccagagaaaaa
atggcacatgcttcaactatggcgggtatggcatttgccaatgcatttttaggagtatgc
cactccatggcccacaaattaggagctgcacaccatatacctcatggaattgccaatgca
cttatgatagatgaagttataaaatttaatgcagtaaatgatccaagaaaacaggcaata
tttcctcagtataaataccctaacgccaagtggagatatgccagaatagctgattatctg
gagttaggtggaaatagtgaagatgaaaaagtagggcttttgataaaggcaatagatgaa
ttaaaagaaaaaataaatattccaaaaaccattagagaggcaggagttgcggagaaaaaa
ttttatgccaccctagatgatatgtcggaacaggcctttgatgatcagtgcacaggggca
aatccaagatatccactcataagtgaaataaaacagatgtatataaatgcctttgataaa
gtaagtcccgttgtagatgaggaagaaaaactaaaggtatctttgttatag

DBGET integrated database retrieval system