KEGG   Clostridium kluyveri DSM 555: CKL_2131Help
Entry
CKL_2131          CDS       T00564                                 

Gene name
cheB2
Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CKL_2131 (cheB2)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CKL_2131 (cheB2)
Enzymes [BR:ckl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CKL_2131 (cheB2)
Two-component system [BR:ckl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CKL_2131 (cheB2)
Bacterial motility proteins [BR:ckl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CKL_2131 (cheB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2164058..2165173)
Genome map
AA seq 371 aa AA seqDB search
MKKIKVLVVDDSALMRKIISDMIKEDSSIEVIGTARNGQDLMDKFSSNFYKTMPDVITMD
VEMPKMDGITALGELKKKNIDIPVIILSSISKEGTKLTMECLAAGAFDFLPKPSGTISLD
IDKVKVELIQKIKVAYFGTSNQNSPIKTISAAENKSYKEIATVRISAENTKKARESKFQP
GRIDAVVMGASTGGPKALTSVITELPKDIGVPVFVVQHMPVGFTKAFAERLNLSSHVKVV
EAQEGMTAEINVVYIAPGGYHMEVWNDKKIHLNKEPAIWGVRPAVDKLFVSASKVYKENI
VSVVLTGMGKDGAEGTVEIKKNGGITISQDEATCTIYGMPKVAYETGKVDLVLPLNDIAK
EMLKIITSGRR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagattaaggttttagtagtagatgattcagcacttatgagaaaaattatctca
gacatgataaaagaggacagttccatagaagtaataggtactgccagaaatggacaggat
cttatggataaattttcttctaatttttataaaactatgccagatgtaataaccatggat
gtagagatgccaaaaatggatggcataactgcacttggagagcttaaaaagaaaaatata
gatatacctgtaataattttaagtagtatttcaaaagaaggtacaaagctcaccatggaa
tgtttagcagcaggagcctttgattttttacctaaaccctctggaaccatatcccttgat
atagataaagtaaaagttgaattgatacaaaaaattaaagtggcttattttggtacatcc
aatcaaaatagtcctattaaaaccataagtgcagctgaaaataaaagttataaagagatt
gccacagtgcgtatttcagctgaaaatactaaaaaagcaagagagagtaaatttcaacca
ggaagaatagatgctgtagtaatgggggcgtctacaggaggacctaaggcacttacttca
gttataacagaactgccaaaagatataggagtgcctgtatttgtggtacagcatatgcct
gtaggttttaccaaagcttttgcagagaggctgaatttaagttctcatgtaaaagtagta
gaagcacaagaaggaatgactgctgaaataaatgttgtatacatagctccaggcgggtat
catatggaagtatggaatgataaaaaaatacacctgaataaagaacctgcaatatgggga
gtgagacctgcggtggataaactatttgtatctgcctcaaaggtgtataaggaaaatata
gttagtgtagttttaacgggaatgggaaaagatggtgcagaaggaactgtggaaattaaa
aaaaatggaggtatcaccatatcgcaagatgaggctacctgtaccatttatggcatgcca
aaagttgcatatgaaacgggaaaagtagatttggttttaccgctaaatgatatagcaaaa
gaaatgttgaaaataataacatctggtaggaggtag

DBGET integrated database retrieval system