KEGG   Clostridium kluyveri DSM 555: CKL_2200Help
Entry
CKL_2200          CDS       T00564                                 

Gene name
dfrD
Definition
protein DfrD (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ckl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ckl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2240514..2240996
Genome map
AA seq 160 aa AA seqDB search
MLSIIVALNENYAIGYNNKLIYHISGDLKRFKKITYGKTIIMGRKTFESLPNILLNRKHI
IITRNPNYNIKSENVFVVHNIKDVIKYEHSKEEYFIIGGGEIYAQLLPYCTKLYLTKIAS
EEKKGDTYFPKFNIHNYNIIEYEKHNENNIEYNFITLEKI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtataattgtagctcttaatgaaaattacgcaataggatataataataagctt
atatatcacatatctggagacttaaaaagattcaaaaaaatcacctatggtaaaacaatt
ataatgggacgaaagacattcgaatctcttccaaacatattattaaatagaaaacatatt
attattacaagaaatcctaactataacattaaatccgaaaatgtattcgtagtacacaat
attaaagatgtgataaaatatgaacactctaaggaagaatactttataataggaggaggg
gaaatctacgcccaattacttccttattgtaccaaattatatttaactaaaatagcttct
gaagaaaaaaaaggtgatacatatttccctaagtttaatatacataattataatataatt
gaatatgaaaaacacaatgaaaataatattgaatacaatttcataactcttgagaagatt
taa

DBGET integrated database retrieval system