KEGG   Clostridium kluyveri DSM 555: CKL_2200Help
Entry
CKL_2200          CDS       T00564                                 

Gene name
dfrD
Definition
protein DfrD (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CKL_2200 (dfrD)
   00670 One carbon pool by folate
    CKL_2200 (dfrD)
Enzymes [BR:ckl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CKL_2200 (dfrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2240514..2240996
Genome map
AA seq 160 aa AA seqDB search
MLSIIVALNENYAIGYNNKLIYHISGDLKRFKKITYGKTIIMGRKTFESLPNILLNRKHI
IITRNPNYNIKSENVFVVHNIKDVIKYEHSKEEYFIIGGGEIYAQLLPYCTKLYLTKIAS
EEKKGDTYFPKFNIHNYNIIEYEKHNENNIEYNFITLEKI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtataattgtagctcttaatgaaaattacgcaataggatataataataagctt
atatatcacatatctggagacttaaaaagattcaaaaaaatcacctatggtaaaacaatt
ataatgggacgaaagacattcgaatctcttccaaacatattattaaatagaaaacatatt
attattacaagaaatcctaactataacattaaatccgaaaatgtattcgtagtacacaat
attaaagatgtgataaaatatgaacactctaaggaagaatactttataataggaggaggg
gaaatctacgcccaattacttccttattgtaccaaattatatttaactaaaatagcttct
gaagaaaaaaaaggtgatacatatttccctaagtttaatatacataattataatataatt
gaatatgaaaaacacaatgaaaataatattgaatacaatttcataactcttgagaagatt
taa

DBGET integrated database retrieval system