KEGG   Clostridium kluyveri DSM 555: CKL_2448Help
Entry
CKL_2448          CDS       T00564                                 

Definition
pirin
Orthology
K06911  
 
Organism
ckl  Clostridium kluyveri DSM 555
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2529099..2529938)
Genome map
AA seq 279 aa AA seqDB search
MSTRAIKKVIKGNIEKDGAGVKLVRILSIGTVKEFDPFLMLDIFDSTNPEDYTKGFPWHP
HRGIDTVTYLINGKIEHKDSMGNIGVIEDGCCQWMTAGSGIIHQEMPQVFELMMGFQLWI
NLPRKNKMCSPKYRSIERKDIGEVKEQGCNIKVISGKYKDTSGDFDGGYVKANILEVKME
ADSKWSFETKEYDTAFIYIFRGYGYFDGGMKNPIYEKSAALFENGDKIEVKSDKEKIHFI
LFTGKPLKEPVAWGGPIVMNSDDELTMAFKELDNGTFIK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccagagcaataaaaaaagtgataaaaggcaatatagaaaaagatggagcggga
gtgaagcttgtcagaatactgtctattggtacagtaaaggagtttgatccatttttaatg
cttgatatttttgattctactaatccagaagattatacaaaaggttttccatggcatccc
cacaggggcatagatacagtaacatatcttataaatgggaaaatagaacataaagacagt
atggggaatataggtgtaattgaagatggatgctgccagtggatgactgcagggagcgga
ataattcatcaggaaatgccacaggtctttgagcttatgatgggatttcaactttggata
aaccttcctagaaaaaataaaatgtgttccccaaaatatagaagtatagaaagaaaagat
ataggtgaagtgaaagaacaaggatgtaatataaaagttatatctggaaaatacaaagat
acaagtggggactttgatggaggatatgtaaaagcaaatattttggaagttaaaatggag
gctgactcaaaatggtcttttgaaacgaaggaatatgatactgcatttatatatattttt
agaggatatggttattttgatggaggaatgaaaaatccaatatatgaaaaaagtgcggct
ctttttgaaaatggtgataaaatagaagtaaaatctgataaagaaaaaattcactttatt
ttatttacaggaaagcctttaaaggaaccagttgcctggggaggccctattgtaatgaat
tcagatgatgaacttactatggcttttaaggaactggataatggaacttttattaagtaa

DBGET integrated database retrieval system