KEGG   Clostridium kluyveri DSM 555: CKL_2967Help
Entry
CKL_2967          CDS       T00564                                 

Definition
iron containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CKL_2967
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_2967
  Lipid metabolism
   00071 Fatty acid degradation
    CKL_2967
  Amino acid metabolism
   00350 Tyrosine metabolism
    CKL_2967
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CKL_2967
   00626 Naphthalene degradation
    CKL_2967
Enzymes [BR:ckl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CKL_2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3020567..3021739
Genome map
AA seq 390 aa AA seqDB search
MENIHDFRLPAINLIGVGALKDLPLELIPYKLSKALIVTDKNIISLGHVEVVEKILKDLS
ISYDIFDGILHPDCTISFVEDALTYFKKGLNILKRDYHFIISIGGGTNHDCAKGIAIVAT
NGGDIEDYEGYKKLKKPSLPVIAINTTSGSGSEVSDSTIVRDNSRRVKMVITDPKMMPII
SVNDLRFMTTMPPKITANSGIDVLTHSIEGFVAIEASPITDTLAINALKLVFEYLRRAYK
NGNDMEAREKMMFAGVMGGMILNNAGLGYVHSMSHQIGALYEEMHGACNAALLPHVLEFN
SISIPEERILKISETMGVKATNKQDAINKIKNGIQNLAEDIGLPTHLSSIGIDKDDLELL
SKNAEKDICSSTNPRRGTFVDIMNIFKAAM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttggagaatattcatgattttcgtttgcctgcaataaatctcattggcgtaggtgctctt
aaagatttaccattagaattaataccttataaattaagcaaagctttaatcgtcacagac
aaaaatataataagtcttggccatgttgaagtagttgaaaaaatattaaaagacttatct
atttcttatgatatatttgatggaatcttacatccagattgtacaatttcatttgtggaa
gatgctcttacatacttcaaaaaaggattaaacatattaaaaagggattatcattttatt
atatccattggaggtggaaccaaccacgattgtgcaaaaggtatagccattgtagcaacc
aatggcggagatatagaagactatgaaggatataaaaagttgaaaaaacctagtttacct
gttatagcaataaatactacttctggatcaggatctgaagtaagtgactccacaattgta
agagataatagtagaagagtaaaaatggttattacagatccgaaaatgatgcctataata
tctgtaaatgatcttagatttatgacaaccatgcctccaaagataactgcgaattctggt
attgatgttttaactcattctatagaaggatttgttgctatagaagcttcacccattaca
gataccttggcaattaatgctttaaagttagtttttgaatatctaagaagagcatataaa
aatggaaatgacatggaagccagagaaaagatgatgtttgctggtgttatgggtggaatg
atccttaacaatgcaggtttaggatatgttcattccatgtcccatcaaataggtgcactt
tatgaggagatgcatggagcttgtaatgcagctctactgcctcatgtgttagagtttaat
tcgatatcaataccagaggaaagaattcttaaaatcagtgaaactatgggagtaaaagcc
actaataaacaggatgctattaataaaattaaaaatggcattcaaaatcttgctgaagat
attggtcttccaactcatttaagttctattggaattgataaagatgatttagagttactt
tccaaaaatgctgaaaaagatatatgttcttctacaaatccaagaagaggaacttttgtg
gatataatgaatatttttaaagctgctatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system