KEGG   Clostridium kluyveri DSM 555: CKL_2967Help
Entry
CKL_2967          CDS       T00564                                 

Definition
iron containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ckl01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ckl00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ckl00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ckl00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ckl00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ckl00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3020567..3021739
Genome map
AA seq 390 aa AA seqDB search
MENIHDFRLPAINLIGVGALKDLPLELIPYKLSKALIVTDKNIISLGHVEVVEKILKDLS
ISYDIFDGILHPDCTISFVEDALTYFKKGLNILKRDYHFIISIGGGTNHDCAKGIAIVAT
NGGDIEDYEGYKKLKKPSLPVIAINTTSGSGSEVSDSTIVRDNSRRVKMVITDPKMMPII
SVNDLRFMTTMPPKITANSGIDVLTHSIEGFVAIEASPITDTLAINALKLVFEYLRRAYK
NGNDMEAREKMMFAGVMGGMILNNAGLGYVHSMSHQIGALYEEMHGACNAALLPHVLEFN
SISIPEERILKISETMGVKATNKQDAINKIKNGIQNLAEDIGLPTHLSSIGIDKDDLELL
SKNAEKDICSSTNPRRGTFVDIMNIFKAAM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttggagaatattcatgattttcgtttgcctgcaataaatctcattggcgtaggtgctctt
aaagatttaccattagaattaataccttataaattaagcaaagctttaatcgtcacagac
aaaaatataataagtcttggccatgttgaagtagttgaaaaaatattaaaagacttatct
atttcttatgatatatttgatggaatcttacatccagattgtacaatttcatttgtggaa
gatgctcttacatacttcaaaaaaggattaaacatattaaaaagggattatcattttatt
atatccattggaggtggaaccaaccacgattgtgcaaaaggtatagccattgtagcaacc
aatggcggagatatagaagactatgaaggatataaaaagttgaaaaaacctagtttacct
gttatagcaataaatactacttctggatcaggatctgaagtaagtgactccacaattgta
agagataatagtagaagagtaaaaatggttattacagatccgaaaatgatgcctataata
tctgtaaatgatcttagatttatgacaaccatgcctccaaagataactgcgaattctggt
attgatgttttaactcattctatagaaggatttgttgctatagaagcttcacccattaca
gataccttggcaattaatgctttaaagttagtttttgaatatctaagaagagcatataaa
aatggaaatgacatggaagccagagaaaagatgatgtttgctggtgttatgggtggaatg
atccttaacaatgcaggtttaggatatgttcattccatgtcccatcaaataggtgcactt
tatgaggagatgcatggagcttgtaatgcagctctactgcctcatgtgttagagtttaat
tcgatatcaataccagaggaaagaattcttaaaatcagtgaaactatgggagtaaaagcc
actaataaacaggatgctattaataaaattaaaaatggcattcaaaatcttgctgaagat
attggtcttccaactcatttaagttctattggaattgataaagatgatttagagttactt
tccaaaaatgctgaaaaagatatatgttcttctacaaatccaagaagaggaacttttgtg
gatataatgaatatttttaaagctgctatgtaa

DBGET integrated database retrieval system