KEGG   Clostridium kluyveri DSM 555: CKL_2996Help
Entry
CKL_2996          CDS       T00564                                 

Gene name
porB
Definition
(GenBank) PorB
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00010  Glycolysis / Gluconeogenesis
ckl00020  Citrate cycle (TCA cycle)
ckl00620  Pyruvate metabolism
ckl00633  Nitrotoluene degradation
ckl00640  Propanoate metabolism
ckl00650  Butanoate metabolism
ckl00680  Methane metabolism
ckl01100  Metabolic pathways
ckl01120  Microbial metabolism in diverse environments
ckl01130  Biosynthesis of antibiotics
ckl01200  Carbon metabolism
Module
ckl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_2996 (porB)
   00020 Citrate cycle (TCA cycle)
    CKL_2996 (porB)
   00620 Pyruvate metabolism
    CKL_2996 (porB)
   00640 Propanoate metabolism
    CKL_2996 (porB)
   00650 Butanoate metabolism
    CKL_2996 (porB)
  Energy metabolism
   00680 Methane metabolism
    CKL_2996 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CKL_2996 (porB)
Enzymes [BR:ckl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CKL_2996 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: EDK35004
UniProt: A5N1K8
Position
complement(3042780..3043712)
Genome map
AA seq 310 aa AA seqDB search
MEYKFKEEMNKPERLVGGHRMCAGCGAPIAVRSVLRALGEKDKAVIGSATGCLEVSTFMY
PYTSWKDSFVHSAFECAGATMGGVERAYTALRKRGKIKEDYKFITFGGDGGTYDIGFQSL
SGAMERGHDMVYVCYDNGAYMNTGIQRSSATPKYADTTTTPVGAVSSGKSQFRKNLTEIM
VSHNIPYVAQTTFLGNFKDIHEKAHRAIYKKGPAFLNVLSPCPRGWRYETADLMNICKLA
VDTCFWPIFEVEDGKWKLNYKPKNKLPIEDFLRPQGRFKHLFKKGNEYMIAELQEEIDKR
WETLLKKCEE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaatttaaagaagaaatgaataagccagaaagattagtgggcggtcataga
atgtgtgctggatgtggtgctcctattgcggtgagaagtgtacttagggctctaggagaa
aaggataaggcagtaataggttctgcaacaggatgtttggaggtttctacatttatgtat
ccatatacatcttggaaggattcttttgtacatagtgcttttgaatgtgcgggagcaact
atgggtggtgtagagagagcatacactgctttaagaaagagaggaaagattaaggaagat
tataaattcataacctttggaggagatggaggaacatatgatataggatttcaatcactg
tctggtgctatggaaagaggccatgacatggtatatgtatgctatgataatggagcatat
atgaatacgggaattcaaaggtcatcagcaactcctaagtatgcagataccacaaccaca
ccagttggagccgtatcatcaggtaaatcacagtttaggaagaatcttacagaaataatg
gtaagccataatataccatatgtagctcagacaacatttttgggaaattttaaagatata
catgaaaaggcccatagggcaatatacaaaaagggaccggcgtttttaaatgtattatcc
ccatgtccaagaggttggagatacgaaaccgctgatttaatgaatatatgtaaattagca
gtggatacatgtttttggcctatttttgaggttgaagatggaaagtggaaattaaattat
aagcctaaaaataagcttccaatagaagacttcttaagaccacagggaagatttaagcac
ttattcaaaaaaggcaatgaatatatgattgctgaattacaagaagagatagataagcgt
tgggaaaccttattaaaaaaatgtgaagaatag

DBGET integrated database retrieval system