KEGG   Clostridium kluyveri DSM 555: CKL_2998Help
Entry
CKL_2998          CDS       T00564                                 

Gene name
porD
Definition
(GenBank) PorD
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKL_2998 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_2998 (porD)
   00020 Citrate cycle (TCA cycle)
    CKL_2998 (porD)
   00620 Pyruvate metabolism
    CKL_2998 (porD)
   00640 Propanoate metabolism
    CKL_2998 (porD)
   00650 Butanoate metabolism
    CKL_2998 (porD)
  Energy metabolism
   00680 Methane metabolism
    CKL_2998 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CKL_2998 (porD)
Enzymes [BR:ckl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     CKL_2998 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3044919..3045218)
Genome map
AA seq 99 aa AA seqDB search
MGKTKINETTKWREMTAGGSIYLSGNSKEFITGSWRVDKPVFIQEKCKQCLLCAPVCPDS
SIPVKEGKRLDFDYDHCKGCGICAEACAFEAIKMVKDEK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacaaagataaatgagacaactaaatggagagaaatgactgcagggggaagt
atatatttaagtggtaattcaaaagaatttattactggaagctggagggtagataagcct
gtatttatacaagaaaagtgtaagcagtgtctattatgtgcaccagtctgtccagacagt
tctatacctgttaaggaaggtaagagattggattttgactatgatcactgcaaagggtgt
ggaatatgtgcagaggcttgtgcatttgaagcaattaagatggtaaaggatgaaaaatag

DBGET integrated database retrieval system