KEGG   Clostridium kluyveri DSM 555: CKL_3062Help
Entry
CKL_3062          CDS       T00564                                 

Gene name
trpB2
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKL_3062 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKL_3062 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKL_3062 (trpB2)
Enzymes [BR:ckl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CKL_3062 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3111923..3113305)
Genome map
AA seq 460 aa AA seqDB search
MSKVPYRVYLSEEEIPRKWYNLRADMKEQHEPYINPGTMKPAKAEDLYAVFCEELAKQEM
DDKTRYVDIPEEVLNFYKIYRPSPLCRAYNLEKALDTPAKIYYKFEGNNTSGSHKLNSAV
AQVYYAKKQGITSLTTETGAGQWGTALSEACAYFEIPLTVYMVKVSSQQKPYRKAIMETF
GAKVIPSPSDTTEAGRAILAKNPNTGGSLGCAISEAIEHAVKTENCRYVLGSVLNQVLLH
QSIIGLETKAAMEKIDTYPDIVIGCAGGGSNLGGLIAPFMQDKLTEKANPYFIAVEPASC
PSLTRGKYAYDFCDTGKITPLAKMYTLGCEFIPSANHAGGLRYHGMSPILSKLYHDGYMD
EARAVEQTRIFDAAALFAKYETILPAPESSHAIRVAIDEALKCKETGEAKTILFGLTGTG
YFDMQAYIQYNENKMSDYIPTDEDLQKGFDALPSIPGIQD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtaccttatagagtttatttgtcagaggaggaaataccacgtaagtggtat
aatcttagggctgatatgaaagaacaacatgagccttacataaatccaggcactatgaaa
cctgcaaaagctgaagatttatatgctgtattctgtgaagaacttgcaaaacaagaaatg
gacgacaaaactagatatgtagatattccagaggaggttcttaatttctataaaatctat
cgtccgtcacctctttgtcgagcatataatctggaaaaagcgctggatacacctgcaaag
atttattacaagtttgagggaaataacacttctggtagccataagctgaattctgctgta
gcacaggtttattatgcaaagaaacaagggattacttcccttactacagaaactggagct
ggtcaatggggcacagctttatctgaagcttgtgcatactttgaaatacctttaacagtt
tatatggttaaggtatcttcccagcagaagccttatcgaaaggcaattatggaaaccttt
ggagcaaaagttattccaagtccatcagatacaaccgaagctgggcgtgctattcttgct
aagaatccaaatacagggggcagtcttggatgtgctatttctgaagctattgaacatgca
gtaaaaacggaaaactgtcgctatgttttgggctctgttcttaatcaagttctccttcac
caatcgattattggtcttgaaactaaagcggctatggaaaaaattgatacttatcctgat
atagtcataggctgtgccggtggaggctctaatcttggtggacttattgctccttttatg
caggataaattaactgaaaaagctaatccttattttatagcagttgaacctgcctcttgt
ccatctcttactagaggaaaatatgcctatgatttttgcgatacgggaaaaatcactcct
ctggcaaagatgtatacattaggttgtgagttcattccttctgctaaccatgcaggtggg
ttacgttatcatggcatgagtccaattctttcaaagctttatcatgatggatatatggat
gaagctcgtgctgtagagcaaacaaggatatttgatgctgctgcattgtttgcaaagtat
gaaacaatacttcctgctccagaatcttcccatgcaattcgtgtggctatcgatgaagca
cttaaatgtaaagaaacaggagaggcaaagacaattttattcggtcttacaggaactggt
tattttgatatgcaggcatatatacagtataatgaaaataaaatgtctgattatatccct
acggatgaggatcttcaaaagggattcgatgctttaccgagtatccctggtattcaagat
taa

DBGET integrated database retrieval system