KEGG   Clostridium kluyveri DSM 555: CKL_3239Help
Entry
CKL_3239          CDS       T00564                                 

Definition
Type III restriction-modification system, modification subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ckl  Clostridium kluyveri DSM 555
Brite
Enzymes [BR:ckl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     CKL_3239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3305268..3307238
Genome map
AA seq 656 aa AA seqDB search
MIKDIMNANDSATPNSREMAVLKENFPSCFRADGSFDIERFKEFLSDKIAVTGEGYELKF
LGKNYARLLASIDTTTVVVPDEEHNSKPENMNSENIYISGDNLDGLKHLLKSYSGQVKCI
YIDPPYNTGTDGFVYNDQFNFTVEELSEKLSISEEQAQRILDLTKRGSASHSAWLMFMYS
RLLLARDLLTDDGVIFISIDDNECHNLKLLCDDVFGEENFIAEFPRITKRGGKSSEIIAK
NHDYVLMYSKTNAPLLFPIAHNDSAFKHKDEFFEERGYYKLNQTLDYDSLQYSKSLDYPI
EIDGEVFYPGSSLELYNERQSGIHDTADWAWRWSKAKFEFGYKNGFIVVKRSKNGSRLYT
KTYQKATIEENDDGYYIEYGDRTKCLSTLETTDNMYSNDNATKDVALTIGKKIFNHTKPL
ALMTLLAKLSTQDSDIILDFFSGSAATAEAIMKLNCDENTRRKYIMVQLPEKCKETSSAY
KNGYRTICDIGIDRIKKAATLLKEEYPDTTVDLGFKHYTLVEPEQNTLDKLEKFDPNENK
LFANKDILSDFGKPTVLATWLVRDGYGLTADAEELNFAGYNGYYIGKHLYLIDPELSNKA
IEAIVVKYETDGSFNPENVVLFGYSFTWTEMEALKINLKRLKDTEKNLRINFDIRY
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggatattatgaatgccaatgatagtgcaacaccgaacagtcgagaaatggct
gtattaaaagaaaatttcccctcatgttttagggcagatggatcctttgatattgagcgg
tttaaggaatttttaagtgataagattgctgtaacgggagagggttatgaacttaagttt
ttgggtaaaaactatgcccgattgctggcttcaattgatactacaacagttgttgtgcca
gacgaggaacataactcaaaacctgaaaatatgaacagtgaaaatatctacataagtggc
gacaaccttgatggattaaagcatctcttgaagtcctattcaggtcaagttaaatgtatt
tatattgatcctccttataacactggaacagatggatttgtgtataatgaccagttcaat
tttactgtggaagagctttcggaaaaactaagtattagcgaagaacaggcacaacgcatt
ttagacttaacaaagagaggttcggcatcgcattcagcatggttgatgtttatgtactca
cgcctcttacttgctagggatttacttacagatgatggcgtaatcttcattagtattgat
gataatgaatgccataatttaaaattattatgtgatgatgtttttggcgaagaaaatttt
attgctgagtttcctagaataactaagcgtggtggaaaatcatcagaaataattgctaaa
aatcatgattatgttcttatgtattcaaaaacgaatgcaccacttctgtttccaatagcc
cataatgacagtgcctttaaacacaaagatgagttttttgaggaacgaggttactacaaa
ttaaatcaaactcttgactatgatagtttacaatatagtaagagtttagattatccaatt
gagatagatggagaagtattttatcctggttcatcattagaattatataatgaacgacaa
tctggaattcatgacacagctgactgggcgtggcgctggagtaaagcaaagtttgaattt
ggatacaaaaatggatttattgttgtaaagcgcagtaaaaatggtagtaggctttatacc
aaaacttatcaaaaagctactattgaagaaaatgatgacggatactacatcgaatatggt
gatcgtactaagtgtttatcgaccttagagacgacagataatatgtattccaatgataat
gcaacaaaagatgttgctttaactattgggaaaaaaatatttaatcatacaaagccatta
gcactaatgactttactagcaaagcttagtactcaggattccgatattattttggatttc
ttttcaggttcagccgcaactgcagaagctattatgaaattgaattgcgatgaaaacact
cgaagaaaatatatcatggtgcaacttcctgaaaaatgtaaagaaacaagttcagcctat
aaaaatggttataggactatatgcgatattggtattgatcgcataaaaaaagccgctact
ttactaaaggaagaatatccagatacaacagttgacctaggctttaagcactatacattg
gttgagcctgagcaaaacactctagacaaacttgaaaagtttgaccctaacgagaataaa
ttatttgctaataaagacattcttagtgattttggaaaacctaccgtccttgcaacgtgg
cttgttagagatggatatggacttacagcagatgctgaggagttaaattttgctggatac
aatggctattatataggaaaacatctttacctaattgacccggaattgtctaataaggcg
attgaagccattgtagtaaaatatgaaactgacggtagctttaatcctgagaacgtggtg
ttatttggttatagttttacatggacggaaatggaagctttaaaaattaatttgaaacgg
ttgaaggatacagagaaaaacttgcgtatcaacttcgatatccgttattga

DBGET integrated database retrieval system