KEGG   Clostridium kluyveri DSM 555: CKL_3363Help
Entry
CKL_3363          CDS       T00564                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CKL_3363
   00052 Galactose metabolism
    CKL_3363
   00500 Starch and sucrose metabolism
    CKL_3363
   00520 Amino sugar and nucleotide sugar metabolism
    CKL_3363
Enzymes [BR:ckl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CKL_3363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3414755..3415636
Genome map
AA seq 293 aa AA seqDB search
MSIKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYVVEEAVNSGIEEILIILGKNK
KSIEDHFDKSVELEDELKSSHKDGLLELIQNISNMVNIYYVRQKEPKGLGHAISLAKAFV
GNEAFAVILGDDIVDSEVPCLKQLINCYNKYNTSIIGVQPVNRKDVSKYGIIDGIQIDDK
VHKIKNMVEKPGKEEAPSNIAILGRYIITPEIFDILERTKPGKGNEIQLTDALKELLKQE
AIYSYCFEGKRYDIGDKLGFIEANIEYALKRTDLRENLISYISDINKKLELNF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtataaaaaaagcagtaattcccgctgctggtttaggaacaagatttttgcctgct
acaaaagcacaacctaaagaaatgttaccaatagtagataagcctacaattcaatatgtg
gtagaagaggccgttaactctggtattgaagaaatattgataatcttaggtaagaataaa
aaatctattgaagatcattttgataaatccgtagaacttgaggatgaattaaaaagcagc
cataaagatggtttgctcgaattgattcaaaatataagtaatatggtaaatatatattat
gtacgtcaaaaagaaccaaaaggattgggtcatgccataagccttgcaaaggcctttgta
ggtaatgaagcttttgctgttatattgggagatgatatagtagatagtgaagtgccctgc
ttgaagcagctaattaactgctataacaagtataatacttcaattataggagtacagcct
gttaacagaaaagatgtatccaaatatggaattattgacggtatacaaatagatgataaa
gttcataagataaaaaatatggtagaaaagcctggaaaagaagaagctccatccaatatt
gccatactggggagatatataataacaccagaaatatttgatatactggagagaactaaa
cctggaaagggtaatgaaattcaacttacagatgcattaaaagaattattaaagcaggag
gcaatatactcttattgttttgaaggtaagcgatatgatataggtgacaagctaggattc
attgaggctaatatagaatatgccttaaaacgtacagatttaagagaaaatcttatttct
tatatttcagacatcaataaaaaattagaactaaatttttaa

DBGET integrated database retrieval system