KEGG   Clostridium kluyveri DSM 555: CKL_3380Help
Entry
CKL_3380          CDS       T00564                                 

Definition
(GenBank) Hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00010  Glycolysis / Gluconeogenesis
ckl00051  Fructose and mannose metabolism
ckl00562  Inositol phosphate metabolism
ckl01100  Metabolic pathways
ckl01110  Biosynthesis of secondary metabolites
ckl01120  Microbial metabolism in diverse environments
ckl01130  Biosynthesis of antibiotics
ckl01200  Carbon metabolism
ckl01230  Biosynthesis of amino acids
Module
ckl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ckl_M00002  Glycolysis, core module involving three-carbon compounds
ckl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_3380
   00051 Fructose and mannose metabolism
    CKL_3380
   00562 Inositol phosphate metabolism
    CKL_3380
Enzymes [BR:ckl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CKL_3380
Exosome [BR:ckl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CKL_3380
  Exosomal proteins of bladder cancer cells
   CKL_3380
  Exosomal proteins of melanoma cells
   CKL_3380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: EDK35383
UniProt: A5N2N7
Position
complement(3430907..3431653)
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKNLEDALELVEELKPLVRGAKCDVVLCPPYVCLDAVVKSVGGTNIKV
GAQNMHYEESGAYTGEISPGMLKSLKVDYVIIGHSERRQYFNEKDETINKKIKKAFEHDI
IPIVCCGESLLERENGITEEVLGRQIKLALKDLRKEQVEKIVIAYEPIWAIGTGKTATDK
QANDTIAHIRGVVSKMYGENAAEVVRIQYGGSVKPATIKAQMEQPHIDGALVGGASLKPQ
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaataatagcgggaaattggaaaatgaataaaaatctagaggatgctttg
gaactggttgaagaattgaagcctcttgtaaggggtgcaaagtgtgatgtagttttatgt
ccgccttatgtttgtcttgatgcagtggttaaatcggtaggtggaaccaatataaaagtt
ggagcacagaatatgcattatgaagaaagtggtgcctacacaggggaaatttctccaggg
atgttaaagtcccttaaagtagattatgttataatcggacacagtgaaagaagacagtat
tttaacgaaaaagatgagacaataaataaaaagataaaaaaagcctttgagcatgatata
atccctatagtttgctgcggggaaagtcttttggagagagaaaatggtataacagaagaa
gtactgggcaggcagataaaactggcacttaaggatctcagaaaggaacaggtggaaaag
attgttatagcttatgaacccatatgggctataggaacaggtaaaactgccacagataaa
caggcaaatgatacaatagctcatataagaggtgtagtttcaaaaatgtatggagaaaat
gcagcagaagtagtaagaattcaatatggaggctctgtaaaacctgctacaattaaagcc
cagatggaacaaccgcatatagatggagcattagttggaggagccagcttaaagccacaa
gattttgcggctatagtaaattattaa

DBGET integrated database retrieval system