KEGG   Clostridium kluyveri DSM 555: CKL_3428Help
Entry
CKL_3428          CDS       T00564                                 

Gene name
cbiN
Definition
cobalt transport protein CbiN
Orthology
K02009  
cobalt/nickel transport protein
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ABC transporters
Module
Cobalt/nickel transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ckl02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3476834..3477151)
Genome map
AA seq 105 aa AA seqDB search
MSVENKTNNIFKKNLLLAFLVILIAVIPLVFMKNAEFAGSDDKAEKAITQIDKSYKPWFS
SVWEPPSGEIESLLFALQAAIGSGVVCYYLGYSKGKSKRVEKDKL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagaaaataaaactaataatatatttaagaaaaatttattattggcttttctt
gtgatattaatagcagttatcccgttagtatttatgaaaaatgctgaatttgcaggttca
gatgataaagcagaaaaggcaatcactcaaattgataaaagctacaagccttggttttct
tcagtgtgggagcctccaagtggtgaaatagaaagccttttatttgcattgcaggcggct
attggttcaggagtagtgtgttattatctgggatattcaaaaggcaagtctaagagagtg
gaaaaagacaaattatga

DBGET integrated database retrieval system