KEGG   Clostridium kluyveri DSM 555: CKL_3428Help
Entry
CKL_3428          CDS       T00564                                 

Gene name
cbiN
Definition
(GenBank) CbiN
  KO
K02009  
cobalt/nickel transport protein
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ABC transporters
Module
Cobalt/nickel transport system
Nickel transport system
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CKL_3428 (cbiN)
Transporters [BR:ckl02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Cobalt transporter [MD:M00245] [OT]
    CKL_3428 (cbiN)
   Nickel transporter [MD:M00246] [OT]
    CKL_3428 (cbiN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3476834..3477151)
Genome map
AA seq 105 aa AA seqDB search
MSVENKTNNIFKKNLLLAFLVILIAVIPLVFMKNAEFAGSDDKAEKAITQIDKSYKPWFS
SVWEPPSGEIESLLFALQAAIGSGVVCYYLGYSKGKSKRVEKDKL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagaaaataaaactaataatatatttaagaaaaatttattattggcttttctt
gtgatattaatagcagttatcccgttagtatttatgaaaaatgctgaatttgcaggttca
gatgataaagcagaaaaggcaatcactcaaattgataaaagctacaagccttggttttct
tcagtgtgggagcctccaagtggtgaaatagaaagccttttatttgcattgcaggcggct
attggttcaggagtagtgtgttattatctgggatattcaaaaggcaagtctaagagagtg
gaaaaagacaaattatga

DBGET integrated database retrieval system