KEGG   Clostridium kluyveri DSM 555: CKL_3559Help
Entry
CKL_3559          CDS       T00564                                 

Gene name
pfk1
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKL_3559 (pfk1)
   01230 Biosynthesis of amino acids
    CKL_3559 (pfk1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_3559 (pfk1)
   00030 Pentose phosphate pathway
    CKL_3559 (pfk1)
   00051 Fructose and mannose metabolism
    CKL_3559 (pfk1)
   00052 Galactose metabolism
    CKL_3559 (pfk1)
  Energy metabolism
   00680 Methane metabolism
    CKL_3559 (pfk1)
Enzymes [BR:ckl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CKL_3559 (pfk1)
Protein phosphatases and associated proteins [BR:ckl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CKL_3559 (pfk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3604770..3605726)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALDKNFNILGIERGYRGLMNGEVVPMERESVADI
IQRGGTILKTARSEEFKTDKGKKIAVGILEKFQVDGLIVIGGDGSFKGAQELSKLGIATI
GIPGTIDNDLAYTDFTIGFDTATNTVLDAINKLRDTSTAHQRVSIVEVMGRNCGDIALYA
GLAGGAENIIIPEKGYEEEELCKNVLEAKLNGKVHNLIVLAEGIGGGEALAKKIQYVTGI
EARATKLGHIQRGGSPTCRDRILASRFGYRAVELLEEGKTSRVIGIKEEKIIDLNIDEAL
NTPRKFDEKLYEIAEALA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctgtgttaactagtgggggagatgcaccaggtatgaatgctgccata
agagcagtggtaaggactgccttggataagaatttcaatatactggggatagaaagagga
tataggggactcatgaatggagaagtagtacctatggaaagagaaagtgtggcagatatt
atacagcggggaggtactatattaaagactgccagatcggaagagtttaaaacagataaa
ggtaaaaaaatagctgtaggtatactggaaaagtttcaagtagacggattgatagtaata
ggtggagatggctccttcaagggagctcaggaattatccaaattaggcatagctaccatt
ggcatacctggaactatagataatgacctagcgtatacggactttaccataggatttgat
acggcaacaaatacagttttagatgcaattaataagttaagagatacttctacagcccat
caaagggtaagtattgtagaagttatgggaagaaactgtggagatatagctctttatgca
ggacttgccggtggggctgaaaatataattataccggaaaaaggatatgaagaagaagaa
ttgtgtaaaaatgtattggaggcaaagctaaatggcaaagtgcataatttgatagtgtta
gcagaaggtataggagggggtgaggctttagcgaaaaagatacagtatgttactggaata
gaagctagagctacaaaattaggacatattcagcgaggaggcagtcctacttgcagggat
agaatattggcttcaaggtttggatatagagcagttgagctattggaagagggaaaaact
tcacgagttattggtattaaagaggaaaagattattgatttaaacatagatgaggcctta
aatacgccaagaaaatttgatgagaaactatatgaaatagcagaagcattagcatga

DBGET integrated database retrieval system