KEGG   Clostridium kluyveri DSM 555: CKL_3559Help
Entry
CKL_3559          CDS       T00564                                 

Gene name
pfk1
Definition
(GenBank) Pfk1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00010  Glycolysis / Gluconeogenesis
ckl00030  Pentose phosphate pathway
ckl00051  Fructose and mannose metabolism
ckl00052  Galactose metabolism
ckl00680  Methane metabolism
ckl01100  Metabolic pathways
ckl01110  Biosynthesis of secondary metabolites
ckl01120  Microbial metabolism in diverse environments
ckl01130  Biosynthesis of antibiotics
ckl01200  Carbon metabolism
ckl01230  Biosynthesis of amino acids
ckl03018  RNA degradation
Module
ckl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKL_3559 (pfk1)
   00030 Pentose phosphate pathway
    CKL_3559 (pfk1)
   00051 Fructose and mannose metabolism
    CKL_3559 (pfk1)
   00052 Galactose metabolism
    CKL_3559 (pfk1)
  Energy metabolism
   00680 Methane metabolism
    CKL_3559 (pfk1)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CKL_3559 (pfk1)
Enzymes [BR:ckl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CKL_3559 (pfk1)
Protein phosphatases and associated proteins [BR:ckl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CKL_3559 (pfk1)
Messenger RNA biogenesis [BR:ckl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CKL_3559 (pfk1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: EDK35550
UniProt: A5N354
Position
complement(3604770..3605726)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALDKNFNILGIERGYRGLMNGEVVPMERESVADI
IQRGGTILKTARSEEFKTDKGKKIAVGILEKFQVDGLIVIGGDGSFKGAQELSKLGIATI
GIPGTIDNDLAYTDFTIGFDTATNTVLDAINKLRDTSTAHQRVSIVEVMGRNCGDIALYA
GLAGGAENIIIPEKGYEEEELCKNVLEAKLNGKVHNLIVLAEGIGGGEALAKKIQYVTGI
EARATKLGHIQRGGSPTCRDRILASRFGYRAVELLEEGKTSRVIGIKEEKIIDLNIDEAL
NTPRKFDEKLYEIAEALA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctgtgttaactagtgggggagatgcaccaggtatgaatgctgccata
agagcagtggtaaggactgccttggataagaatttcaatatactggggatagaaagagga
tataggggactcatgaatggagaagtagtacctatggaaagagaaagtgtggcagatatt
atacagcggggaggtactatattaaagactgccagatcggaagagtttaaaacagataaa
ggtaaaaaaatagctgtaggtatactggaaaagtttcaagtagacggattgatagtaata
ggtggagatggctccttcaagggagctcaggaattatccaaattaggcatagctaccatt
ggcatacctggaactatagataatgacctagcgtatacggactttaccataggatttgat
acggcaacaaatacagttttagatgcaattaataagttaagagatacttctacagcccat
caaagggtaagtattgtagaagttatgggaagaaactgtggagatatagctctttatgca
ggacttgccggtggggctgaaaatataattataccggaaaaaggatatgaagaagaagaa
ttgtgtaaaaatgtattggaggcaaagctaaatggcaaagtgcataatttgatagtgtta
gcagaaggtataggagggggtgaggctttagcgaaaaagatacagtatgttactggaata
gaagctagagctacaaaattaggacatattcagcgaggaggcagtcctacttgcagggat
agaatattggcttcaaggtttggatatagagcagttgagctattggaagagggaaaaact
tcacgagttattggtattaaagaggaaaagattattgatttaaacatagatgaggcctta
aatacgccaagaaaatttgatgagaaactatatgaaatagcagaagcattagcatga

DBGET integrated database retrieval system