KEGG   Clostridium kluyveri DSM 555: CKL_3559Help
Entry
CKL_3559          CDS       T00564                                 

Gene name
pfk1
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ckl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ckl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ckl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ckl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ckl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ckl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ckl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3604770..3605726)
Genome map
AA seq 318 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALDKNFNILGIERGYRGLMNGEVVPMERESVADI
IQRGGTILKTARSEEFKTDKGKKIAVGILEKFQVDGLIVIGGDGSFKGAQELSKLGIATI
GIPGTIDNDLAYTDFTIGFDTATNTVLDAINKLRDTSTAHQRVSIVEVMGRNCGDIALYA
GLAGGAENIIIPEKGYEEEELCKNVLEAKLNGKVHNLIVLAEGIGGGEALAKKIQYVTGI
EARATKLGHIQRGGSPTCRDRILASRFGYRAVELLEEGKTSRVIGIKEEKIIDLNIDEAL
NTPRKFDEKLYEIAEALA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctgtgttaactagtgggggagatgcaccaggtatgaatgctgccata
agagcagtggtaaggactgccttggataagaatttcaatatactggggatagaaagagga
tataggggactcatgaatggagaagtagtacctatggaaagagaaagtgtggcagatatt
atacagcggggaggtactatattaaagactgccagatcggaagagtttaaaacagataaa
ggtaaaaaaatagctgtaggtatactggaaaagtttcaagtagacggattgatagtaata
ggtggagatggctccttcaagggagctcaggaattatccaaattaggcatagctaccatt
ggcatacctggaactatagataatgacctagcgtatacggactttaccataggatttgat
acggcaacaaatacagttttagatgcaattaataagttaagagatacttctacagcccat
caaagggtaagtattgtagaagttatgggaagaaactgtggagatatagctctttatgca
ggacttgccggtggggctgaaaatataattataccggaaaaaggatatgaagaagaagaa
ttgtgtaaaaatgtattggaggcaaagctaaatggcaaagtgcataatttgatagtgtta
gcagaaggtataggagggggtgaggctttagcgaaaaagatacagtatgttactggaata
gaagctagagctacaaaattaggacatattcagcgaggaggcagtcctacttgcagggat
agaatattggcttcaaggtttggatatagagcagttgagctattggaagagggaaaaact
tcacgagttattggtattaaagaggaaaagattattgatttaaacatagatgaggcctta
aatacgccaagaaaatttgatgagaaactatatgaaatagcagaagcattagcatga

DBGET integrated database retrieval system