KEGG   Clostridium kluyveri DSM 555: CKL_3670Help
Entry
CKL_3670          CDS       T00564                                 

Definition
exodeoxyribonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ckl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3711413..3713665)
Genome map
AA seq 750 aa AA seqDB search
MQELQGVVEDIIFQNKDNGYTVAKIKEKEDTITIVGCIPYIIEGQNLEVSGEWVVHPEFG
HQFKVKLFKEIIPDTLVGIEKYLSSGIISGIGPVTAKKIVEKFGKDTLHILDNNIERLKE
IEGIGSKKISLIEKSYCKQYEIRNIMIFMQTYGVTPNQCVKIYKKLGVNSINIVKENPYI
LTEEISGIGFKIADKIARGLGIEKDSPFRVQSGIKYLINKFCSRGNTYVPIDVLIRNGMS
ILGVSQKELEKNIYESSLNGKIKVEKYGDKICVFSMTYYYCELSVTKKILTLAFNKCKDI
DLNIYEEIKNFEKANNIKFAFSQKEAIKGSVENSVEIITGGPGTGKTTIINCMIQLFEKS
NLKVLMAAPTGRAAKRMSEATKREAKTIHRLLEIGVESDDEALFFSRGEESPLQCDVVII
DEASMIDIVMMNNLLKAISLKTRLIIVGDSEQLPSVGPGNVLRDLIDSRCIKVVRLKEIF
RQSRESMIIVNAHKINLGEMPILNKKLKDFYFIKALEFSNILNLLVELANKRLPAFNGHW
DKMKHIQILSPMRKGILGVSNLNRKLQEALNPKSNNKKEKYFRDMIFRVGDKVMQIKNNY
TLKWTVISGEKEEKGMGIFNGDFGYIEDIDEEKDTVTVIFDEEKRVVYDSICLDELDLAY
GITIHKSQGSEFPVIIVPMFMGPVLLMNRNLLYTAITRAKEMVVLVGDLRALTFMISNNK
SFERYSLLKYRIMDIMESEVDVTLEQNEFR
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaattacagggagttgtagaagatataatatttcaaaataaggataatgggtac
acagtggctaagataaaagagaaagaagatacaataactatagttggatgtataccttat
ataatagaaggacaaaatttggaggtttcaggagagtgggtagttcatcctgaatttggc
catcaatttaaagttaaactgtttaaagagataattccagataccttagttggcatagaa
aagtatctgtcttcaggtattatatcaggcataggaccagttactgcaaaaaagatagta
gaaaagtttgggaaagatacactccatatattagataacaatatagaaaggttaaaagaa
atagagggcataggatcaaaaaagatatccttaatagaaaaatcttattgtaagcaatat
gaaataagaaatataatgatatttatgcaaacttatggagtaacccctaatcaatgtgta
aaaatatacaaaaagttgggagttaactcaataaatatagtaaaagaaaatccctatatt
cttacagaagaaatatcaggaataggattcaaaatagcagataaaatagcaagaggtctt
ggcatagaaaaggattctccctttagagtacaaagtggtataaaatatttaataaataaa
ttttgcagcagaggaaatacttatgtgcccatagacgtattgataagaaatggaatgagt
atacttggagtgagtcaaaaggaactggagaaaaatatatatgaaagctccttaaatgga
aaaataaaggtagaaaaatacggagataagatttgtgtattctccatgacatattattat
tgcgaattaagtgtaactaagaagatattgacattagcttttaataagtgtaaagatata
gatttaaatatatatgaggaaattaaaaattttgaaaaggccaataacataaaatttgct
ttttcacaaaaagaagcaattaaaggatcagtagaaaatagtgtagaaataataacagga
gggcctggaacaggaaagactactattattaattgtatgattcagttatttgaaaaatca
aacttgaaagtccttatggcggcacctactggaagggctgcaaagagaatgtcagaggca
actaaaagagaggcgaaaactatacatagattacttgaaataggtgtagaaagtgatgat
gaagcattatttttttctcgtggagaagaatctccccttcaatgtgatgtggtaattata
gatgaagcctctatgatagatatagtaatgatgaataatttattaaaagctatttcatta
aaaactagacttataatagtaggagattcagagcagcttccttctgtaggacctggaaat
gtacttagagatctgatagatagccggtgcattaaggtagtcagattaaaagaaatattt
agacagtcaagagagagcatgattatagtaaatgcccataaaataaatttaggagaaatg
ccgatcctaaataaaaaacttaaagatttttattttataaaagccttggaattctccaat
atattaaatcttctagtagaattagcaaataaaagattacctgcatttaatggacattgg
gataaaatgaaacacattcaaatactatctcccatgagaaaaggaattttaggagtatca
aatttaaatagaaaacttcaggaagctttaaatcctaaaagtaataataaaaaagaaaag
tattttagagatatgatttttagagttggagataaggtaatgcaaattaaaaataactat
actttaaagtggacagtaatttcaggagaaaaagaggaaaaaggtatgggcatttttaat
ggagattttggatatattgaagatattgatgaagagaaggatacagtaactgttatattt
gacgaagagaaaagagttgtatatgacagtatatgtttagatgaattagatttagcttat
ggaataactatacataaaagccaggggagtgaatttccagttattattgttcctatgttt
atggggccggttttacttatgaataggaatttactatatacagctataactagggcaaaa
gagatggtggtacttgtaggagatttaagagctttaacctttatgataagtaataataaa
agttttgagaggtattccttattaaaatatagaataatggatataatggagagtgaagtg
gatgttactttggaacaaaatgagtttcgctga

DBGET integrated database retrieval system