KEGG   Clostridium kluyveri DSM 555: CKL_3670Help
Entry
CKL_3670          CDS       T00564                                 

Definition
(GenBank) Predicted exodeoxyribonuclease
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CKL_3670
Enzymes [BR:ckl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CKL_3670
DNA repair and recombination proteins [BR:ckl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CKL_3670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD HHH_5 PIF1 DNA_pol_lambd_f PhoH UvrD_C AAA_22 DEAD T2SSE SRP54 NTPase_1 DUF2075 Herpes_Helicase AAA HHH_2 AAA_10 RsgA_GTPase AAA_24 AAA_12 DUF853 AAA_29 TrwB_AAD_bind cobW HHH_3 AAA_28 MobB ABC_tran UvrD-helicase AAA_5 CbiA AAA_16 Flavi_DEAD ResIII
Motif
Other DBs
NCBI-ProteinID: EDK35660
UniProt: A5N3G4
Position
complement(3711413..3713665)
Genome map
AA seq 750 aa AA seqDB search
MQELQGVVEDIIFQNKDNGYTVAKIKEKEDTITIVGCIPYIIEGQNLEVSGEWVVHPEFG
HQFKVKLFKEIIPDTLVGIEKYLSSGIISGIGPVTAKKIVEKFGKDTLHILDNNIERLKE
IEGIGSKKISLIEKSYCKQYEIRNIMIFMQTYGVTPNQCVKIYKKLGVNSINIVKENPYI
LTEEISGIGFKIADKIARGLGIEKDSPFRVQSGIKYLINKFCSRGNTYVPIDVLIRNGMS
ILGVSQKELEKNIYESSLNGKIKVEKYGDKICVFSMTYYYCELSVTKKILTLAFNKCKDI
DLNIYEEIKNFEKANNIKFAFSQKEAIKGSVENSVEIITGGPGTGKTTIINCMIQLFEKS
NLKVLMAAPTGRAAKRMSEATKREAKTIHRLLEIGVESDDEALFFSRGEESPLQCDVVII
DEASMIDIVMMNNLLKAISLKTRLIIVGDSEQLPSVGPGNVLRDLIDSRCIKVVRLKEIF
RQSRESMIIVNAHKINLGEMPILNKKLKDFYFIKALEFSNILNLLVELANKRLPAFNGHW
DKMKHIQILSPMRKGILGVSNLNRKLQEALNPKSNNKKEKYFRDMIFRVGDKVMQIKNNY
TLKWTVISGEKEEKGMGIFNGDFGYIEDIDEEKDTVTVIFDEEKRVVYDSICLDELDLAY
GITIHKSQGSEFPVIIVPMFMGPVLLMNRNLLYTAITRAKEMVVLVGDLRALTFMISNNK
SFERYSLLKYRIMDIMESEVDVTLEQNEFR
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaattacagggagttgtagaagatataatatttcaaaataaggataatgggtac
acagtggctaagataaaagagaaagaagatacaataactatagttggatgtataccttat
ataatagaaggacaaaatttggaggtttcaggagagtgggtagttcatcctgaatttggc
catcaatttaaagttaaactgtttaaagagataattccagataccttagttggcatagaa
aagtatctgtcttcaggtattatatcaggcataggaccagttactgcaaaaaagatagta
gaaaagtttgggaaagatacactccatatattagataacaatatagaaaggttaaaagaa
atagagggcataggatcaaaaaagatatccttaatagaaaaatcttattgtaagcaatat
gaaataagaaatataatgatatttatgcaaacttatggagtaacccctaatcaatgtgta
aaaatatacaaaaagttgggagttaactcaataaatatagtaaaagaaaatccctatatt
cttacagaagaaatatcaggaataggattcaaaatagcagataaaatagcaagaggtctt
ggcatagaaaaggattctccctttagagtacaaagtggtataaaatatttaataaataaa
ttttgcagcagaggaaatacttatgtgcccatagacgtattgataagaaatggaatgagt
atacttggagtgagtcaaaaggaactggagaaaaatatatatgaaagctccttaaatgga
aaaataaaggtagaaaaatacggagataagatttgtgtattctccatgacatattattat
tgcgaattaagtgtaactaagaagatattgacattagcttttaataagtgtaaagatata
gatttaaatatatatgaggaaattaaaaattttgaaaaggccaataacataaaatttgct
ttttcacaaaaagaagcaattaaaggatcagtagaaaatagtgtagaaataataacagga
gggcctggaacaggaaagactactattattaattgtatgattcagttatttgaaaaatca
aacttgaaagtccttatggcggcacctactggaagggctgcaaagagaatgtcagaggca
actaaaagagaggcgaaaactatacatagattacttgaaataggtgtagaaagtgatgat
gaagcattatttttttctcgtggagaagaatctccccttcaatgtgatgtggtaattata
gatgaagcctctatgatagatatagtaatgatgaataatttattaaaagctatttcatta
aaaactagacttataatagtaggagattcagagcagcttccttctgtaggacctggaaat
gtacttagagatctgatagatagccggtgcattaaggtagtcagattaaaagaaatattt
agacagtcaagagagagcatgattatagtaaatgcccataaaataaatttaggagaaatg
ccgatcctaaataaaaaacttaaagatttttattttataaaagccttggaattctccaat
atattaaatcttctagtagaattagcaaataaaagattacctgcatttaatggacattgg
gataaaatgaaacacattcaaatactatctcccatgagaaaaggaattttaggagtatca
aatttaaatagaaaacttcaggaagctttaaatcctaaaagtaataataaaaaagaaaag
tattttagagatatgatttttagagttggagataaggtaatgcaaattaaaaataactat
actttaaagtggacagtaatttcaggagaaaaagaggaaaaaggtatgggcatttttaat
ggagattttggatatattgaagatattgatgaagagaaggatacagtaactgttatattt
gacgaagagaaaagagttgtatatgacagtatatgtttagatgaattagatttagcttat
ggaataactatacataaaagccaggggagtgaatttccagttattattgttcctatgttt
atggggccggttttacttatgaataggaatttactatatacagctataactagggcaaaa
gagatggtggtacttgtaggagatttaagagctttaacctttatgataagtaataataaa
agttttgagaggtattccttattaaaatatagaataatggatataatggagagtgaagtg
gatgttactttggaacaaaatgagtttcgctga

DBGET integrated database retrieval system