KEGG   Clostridium kluyveri DSM 555: CKL_3685Help
Entry
CKL_3685          CDS       T00564                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ckl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ckl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3724688..3725947)
Genome map
AA seq 419 aa AA seqDB search
MSKIVIKGGSNLHGEVNISAAKNSVLPIIAASILSGDKCIIDNVPMLEDVFVISNILKSI
SADVTIDKKLNKIIIDTSNISYCDPCSELVKKMRASFLIMGPMISRFGGFKLCLPGGCNI
GTRPIDLHLKGFAALGAKVNVEHGFVEAKAKKLIGNKIYLDFPSVGATENIMMAAVTAEG
ETIIENAAEEPEIKDLADFLNSMGANITGAGSRAIHIKGVKNLKGSSHSPICDRIESGTF
MVAAAITKSKIRINGINEEYLKPIIAKLTEAGVYIRCEGNSLIVDGNRELNPIDIKTMPY
PGFPTDMQSQVTGLLSTVKGTSIVTETIFENRFMHVMEMKRMGANIKIDGRSAVIEGVDK
LTGAEVKATDLRAGAALILCGLAAEGKTEVIDIYHIDRGYVDIEKKLKLLGADIERVNE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatagtaattaaagggggaagtaacctccatggagaagttaatatcagtgct
gctaaaaattcagtgttgcctattatagcagcttccattttaagtggagataagtgcatt
atagataatgttcccatgttggaagatgtttttgtgataagtaatatattaaaaagtata
tctgcagatgtaactatagataaaaaattaaataagattattatagatacttctaatata
agttattgtgatccctgtagtgaactagtgaaaaaaatgagggcatcatttttaataatg
ggacctatgatatccagattcggaggatttaaattatgtcttcctggagggtgtaatatt
ggaactagaccaatagacttacatttaaaagggtttgctgctcttggtgcaaaggtaaat
gtagagcatggatttgtggaagcaaaagctaaaaaattaataggaaataaaatatatttg
gattttccatcagtaggggccacagaaaatataatgatggcagcagtaaccgctgaaggg
gagactataatagaaaatgcagcggaagaaccggaaataaaagatctggcagactttttg
aatagtatgggtgcaaatattactggtgcagggtctagagctattcacataaaaggagta
aaaaatttaaaaggaagtagtcatagtcccatatgtgacaggatagaatcaggaacattt
atggtagctgctgctataaccaaaagcaagattagaataaatggcataaatgaagagtat
ctaaagcctataattgctaaacttacagaagccggggtatatataagatgcgagggaaat
agtttaattgtagatggaaatagagaattaaatcctatagatattaagactatgccttat
ccaggatttcctacagatatgcaatcacaggtaactggtttattaagtacagttaaaggt
acaagtattgtaacagaaaccatttttgaaaatagatttatgcatgtaatggaaatgaaa
agaatgggagcaaatataaagatagatggaagaagtgcagttatagaaggagttgataag
cttacaggagcagaagtaaaagctacagatcttagagctggtgcagcactcatactttgc
ggattagcggcagaagggaaaacagaagttatagatatatatcatatagatagagggtat
gtagatattgaaaaaaaattaaaattattaggagctgatattgaaagagtaaatgaataa

DBGET integrated database retrieval system