KEGG   Clostridium kluyveri DSM 555: CKL_3696Help
Entry
CKL_3696          CDS       T00564                                 

Gene name
thlA1
Definition
(GenBank) ThlA1
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKL_3696 (thlA1)
   00630 Glyoxylate and dicarboxylate metabolism
    CKL_3696 (thlA1)
   00640 Propanoate metabolism
    CKL_3696 (thlA1)
   00650 Butanoate metabolism
    CKL_3696 (thlA1)
  Lipid metabolism
   00071 Fatty acid degradation
    CKL_3696 (thlA1)
   00072 Synthesis and degradation of ketone bodies
    CKL_3696 (thlA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKL_3696 (thlA1)
   00310 Lysine degradation
    CKL_3696 (thlA1)
   00380 Tryptophan metabolism
    CKL_3696 (thlA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKL_3696 (thlA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKL_3696 (thlA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CKL_3696 (thlA1)
Enzymes [BR:ckl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CKL_3696 (thlA1)
Exosome [BR:ckl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CKL_3696 (thlA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3734524..3735705)
Genome map
AA seq 393 aa AA seqDB search
MREVVIVSAVRTAIGSFGGTLKDVSAVDLGAIVIKEAVKRAGIKPEQVDEVIFGNVIQAG
VGQSLARQSAVYAGLPVEVPAFTVNKLCGSGLRTVSLAASLISNGDADTIVVGGSENMSA
SPYLIPKARFGYRMGEAKIYDAMLHDGLIDSFNNYHMGITAENIAEKWGITREDQDKFAL
ASQQKAEAAIKAGKFKDEIVPVTVKMKKKEVVFDTDEDPRFGTTIETLAKLKPAFKRDGT
GTVTAGNSSGINDSSAALILMSADKAKELGVKPMAKYVDFASAGLDPAIMGYGPYYATKK
VLAKTNLTIKDFDLIEANEAFAAQSIAVARDLEFDMSKVNVNGGAIALGHPVGCSGARIL
VTLLHEMQKRDAKKGLATLCIGGGQGTAVVVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtagttattgtaagtgctgtaagaacagcgataggaagttttgggggaact
ttaaaagatgtttctgctgtagatttaggagctatagttataaaagaagcagtaaaaaga
gcaggtatcaaaccagaacaagtagatgaagttatatttggaaatgtaatacaagcaggt
gttggacaaagtttagcaagacaatcagctgtatatgcaggtcttccagtagaagtacca
gctttcacagtgaataagctttgtggttcaggacttagaacagtaagtttagcagctagt
cttatcagcaacggagatgctgatacaattgtagttggtggatcagaaaacatgtctgca
tctccatatttaattccaaaagctagatttggatatagaatgggagaagcaaaaatatat
gatgctatgttacatgatggacttatagattcattcaacaactatcacatgggaatcaca
gctgaaaatatagcagaaaaatggggaataacaagagaagatcaagataaatttgcatta
gcatcccaacagaaggcagaagcagctataaaagcaggaaagttcaaagatgaaatagtt
ccagtaactgtaaaaatgaaaaagaaagaggtagtttttgatactgatgaagatccaaga
tttggtacaactatagaaacattagcaaaattgaaacctgcatttaagagagatggaaca
ggaacagttacagcaggtaattcttcaggaataaatgattcatcagcagcattaatctta
atgagtgcagataaagcaaaggaacttggagttaaaccaatggcaaaatatgttgatttt
gcaagcgcaggattagatccagctatcatgggatatggaccatattatgcaacaaaaaaa
gtgcttgcgaaaactaatttaacaataaaggactttgatttaatagaagcaaatgaagca
tttgcagctcaaagtatagcagtagcaagagatttagaatttgatatgagcaaagtaaat
gtaaatggaggagcaatagctcttggacatccagttggctgctctggtgcaagaatactt
gttacactacttcacgaaatgcaaaagagagatgcaaagaaaggtcttgcaacactttgc
ataggtggaggacaaggaaccgctgtagtagttgaaagataa

DBGET integrated database retrieval system