KEGG   Clostridium kluyveri DSM 555: CKL_3724Help
Entry
CKL_3724          CDS       T00564                                 

Gene name
ispE
Definition
(GenBank) IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
ckl00900  Terpenoid backbone biosynthesis
ckl01100  Metabolic pathways
ckl01110  Biosynthesis of secondary metabolites
ckl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CKL_3724 (ispE)
Enzymes [BR:ckl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CKL_3724 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: EDK35709
UniProt: A5N3L3
Position
complement(3764648..3765490)
Genome map
AA seq 280 aa AA seqDB search
MLIKAYAKINLSLDVIGKREDGYHLLKMIMQTIDLYDLLNITPIEKGIEIKCNKSYIPCD
KRNLVYKAVELFASNYGIKSGVSIDIIKNIPVAAGLAGGSSDAAAVLKVMRDIYIPELEY
KDLIKLGTSIGADVPYCMIGGTALCQGIGEKVTSISSFKNHILVLVKPFFGVSTAEVYKS
LDISKIKIHPNTDILINAINSGSLLKVSKNMKNVLENVTLKKHPLLRKIKNELIDFGALG
ALMSGSGPSIFAFFDDMLKAQICYDKMKTKYKEVFITRTV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttaataaaagcctatgccaaaataaacctttcattagatgtaataggaaaaagagaa
gatggatatcatcttttaaagatgataatgcaaactatagatttatatgatcttttaaat
ataactcctattgaaaaaggaatagaaataaaatgtaataagtcatatattccatgtgat
aaaagaaatttagtatataaggcagtagaattatttgcaagcaactatggcataaaaagt
ggagtaagtatagatataattaaaaatatacctgtagcagctggacttgcgggaggaagt
tcagatgcagctgcagtattaaaagttatgagagatatatacatacctgaattagaatat
aaagatttaattaaattaggaacaagcattggggcagatgtaccttattgtatgataggg
ggaactgctctatgccagggtataggagaaaaagttacatctatttcttcttttaaaaat
catattttagtattagttaaaccattttttggcgtaagtactgcagaggtatataaaagt
ttggatataagtaaaataaagattcatcccaatacggatatattaataaatgccataaat
tcaggttcgctgttgaaagtgagtaaaaatatgaaaaatgtattggaaaatgtaacttta
aaaaaacaccctttattaagaaaaataaaaaatgagttaattgattttggtgcattaggt
gctttgatgagtggaagtggtccaagtatatttgctttttttgatgatatgttaaaagca
caaatatgttatgataaaatgaaaactaaatataaagaagtgtttattacaagaactgta
taa

DBGET integrated database retrieval system