KEGG   Clostridium kluyveri DSM 555: CKL_3808Help
Entry
CKL_3808          CDS       T00564                                 

Definition
(GenBank) Predicted hydrolase
Organism
ckl  Clostridium kluyveri DSM 555
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3859059..3860012)
Genome map
AA seq 317 aa AA seqDB search
MDKLLLKLINSFGISGKEDEIRQVIKESLKESDHDIHEDNIGNILVKVGTGKSKVMICSN
MDSVGFIVNDIEEDGMIKVNSIGEFNTQDISHSFIRFHNGTLGKVWTSSKGVFVDIGTSN
REDTLKKIKEGDMASLVGPYLKVGNNNIISPLLHNKVGCYILLKLLENIKINNTEFNFVF
ASQGEIGGIGARIAANTINPDYCIIVGVENTKNKEETKIDIGDGPVLKIMDSSLIMHKDI
KDILENAAERADVKFQYSISTGKSQGGLVHKERIGIRTGEIAVPCRYKYSTSEMISIYDI
ENTIKVLNELENFKELI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggataagcttttgttaaaattaattaattcttttgggattagtggaaaagaagatgaa
attagacaagtgataaaagagagtttaaaggaatccgatcatgatatacatgaagataat
ataggtaatatattagtgaaagtgggaactggtaaaagtaaagttatgatatgttctaat
atggattcagtgggatttatagttaatgatatagaagaagatggaatgataaaagtaaat
agtataggagagtttaatactcaggatatatcacatagctttataagatttcataatggc
acactgggtaaagtatggacatcttcaaaaggtgtctttgtggatataggtacaagtaac
agggaagatacattaaaaaagataaaagaaggagacatggcatcacttgtgggaccttat
ttaaaagtgggaaataataatataataagtcccttgcttcataataaggtgggatgttat
atacttttgaagcttttagaaaatattaaaataaataatactgaatttaattttgtattt
gcttctcaaggagaaattggaggaataggtgcaagaatagctgcaaatactataaatcct
gactattgtataatagtaggcgttgaaaacacaaaaaataaagaggaaacaaaaatagat
ataggtgatggacccgtattaaaaatcatggatagttctttgataatgcataaagatata
aaggatatattagaaaatgctgctgaaagagcggatgtaaaatttcagtacagtataagc
acaggtaaatcccaaggaggacttgtacataaagagcggataggcataagaactggcgag
attgcagtaccatgtagatataaatattctacttcagagatgatatctatttatgatata
gaaaatactataaaggtattaaatgaattagaaaattttaaggagctgatataa

DBGET integrated database retrieval system