KEGG   Clostridium kluyveri DSM 555: CKL_3809Help
Entry
CKL_3809          CDS       T00564                                 

Definition
hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ckl  Clostridium kluyveri DSM 555
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ckl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKL_3809
Enzymes [BR:ckl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CKL_3809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3860035..3861054)
Genome map
AA seq 339 aa AA seqDB search
MFLEKLCNSTGPSGYEEHIRNVIRDELSTFTDNILIDRMGNIIVHKDRQNDSSSKIMVIS
HIDESGLIITAYNKDGTLKFSTLGDIDKNSLPAKAVLIGDKKIPGVIGMKPIHIQSKKER
DENISYENMCIDIGAFSQEECRRIISLGDFVVFNNKFSHFGDNLLKGKALDNRVGCSILI
ELLKEDLNCNLYGVFNVQGNIDQRGIHAVAYNIDPDLVIILDTINSIDYMEIPSYFRTSK
LREGPVIPFKGGQCIFDRGIVESIRNKADDIGIPYQKIGDTHGEGELKAAYLTVNNCKTA
SILLPCRYMNFNISICSLADYDNTLFLLKSYLEDCSINI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttagaaaaactctgtaattctacaggaccttcgggatatgaggaacacattagg
aatgtaataagagatgaattaagtacttttactgacaatatacttatagatagaatggga
aatattatagtgcataaggatagacaaaatgattcttcatctaaaataatggtgatttct
cacatagatgaatcaggtctcataataacagcttataataaagatggaacactaaaattt
tccacattaggggatatagataaaaattcacttcctgctaaggctgttttaattggagat
aaaaaaataccaggagttattggaatgaagccaatacatattcagagtaaaaaagaaaga
gatgaaaatatatcctatgaaaatatgtgtatagatataggcgctttttcccaagaggaa
tgtagaaggattatatcattaggggattttgtagtatttaataataaattttctcatttt
ggagataaccttttaaaaggaaaagctctagataatagagtaggatgttctatacttata
gagttattgaaggaagacttaaattgcaacttatatggtgtatttaatgttcagggaaat
atagaccaaagaggaattcatgcggttgcttacaatattgatccagatttagtcataatt
ttagataccataaatagtatagattatatggaaattcccagttatttcaggacaagtaaa
ttaagagaaggtcctgttataccttttaaaggtggacagtgtatattcgatagaggtatt
gtagaatctatccggaataaagcagatgacataggaataccatatcaaaaaattggagat
actcatggagaaggagaacttaaagcagcttatcttactgttaataattgtaaaactgca
tcgatattattaccatgtagatacatgaattttaatatttctatatgcagtttagctgat
tatgataatactttatttttattaaaaagctatttagaggactgtagtataaatatttag

DBGET integrated database retrieval system