KEGG   Caldicellulosiruptor kronotskyensis: Calkro_0391Help
Entry
Calkro_0391       CDS       T01357                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calkro_0391
Enzymes [BR:ckn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Calkro_0391
Amino acid related enzymes [BR:ckn01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Calkro_0391
Transfer RNA biogenesis [BR:ckn03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Calkro_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
507786..509243
Genome map
AA seq 485 aa AA seqDB search
MEVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIES
LRWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEAQRQEL
LSKGQMPRYTGKCRNLTEDQKRRFEQEGRKPTVRFKVPEGVKIVVHDLVRGNVEFLSDDI
GDFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHV
SLILGKDRTKMSKRHGSTWVEQYKDQGYLKEGLINFLALLGWSPPEDKEIFDMEYLIENF
SLERVSKNPAIFDIDKLNYINSQHIKLKSLDELTQMCIPYFVEAGYIKEDEAQSKFEWLK
KIVKSVYEGLDYLSQIKDRVDVFFNNEIKIEEDEAKEVLKWDHVKDLINVFENKIRQMNE
LTPEAIKLLFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKENILKRLEFF
KTWYN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtaagaacaaggtttgcaccaagtccgacagggcatcttcacataggcggtgca
agaacagcactttttaattacctttttgccaaaagatatgggggaaagtttatattaagg
atagaagacacagatttagaaagatcgtctattgagtctgaaaaggttataatagagagt
ttgagatggcttgggattgagtgggatgaaggtgttgaggtagggggtccctacggtcct
tataggtcgacagaaagagtggatatttacaaaaaatatgttgatgttctttttgaaaaa
ggctacgcatactattgttactgcacagaagaggagcttgaggctcaaagacaagagctt
ttatcaaaaggtcagatgccaaggtatacaggaaaatgtagaaacctaacagaggatcag
aagagaagatttgagcaggaggggagaaaaccaactgtaaggttcaaagtgccagaaggt
gttaagatagttgtccatgatttggtaagaggcaatgttgagtttttgagtgatgacata
ggcgactttgtaattgtcaaatctgatggaattcccacatacaactttgcggttgtcata
gatgaccacttaatgaagatttcgcatgttataaggggtgaagagcatctttcaaacact
ccacgccagattctaatttacaatgcgcttgggtttgaacttccgcagtttgctcatgtt
tcgctcatacttggaaaagacagaacaaagatgtcaaagcgccacggttctacttgggtt
gagcagtataaagatcaagggtatttaaaagaaggacttataaacttcttggctctgctt
ggctggtcaccaccagaagataaggaaatatttgacatggaatatctaattgagaatttc
tcattagaaagagtttcaaaaaatcctgcaatatttgacattgataagctaaattatata
aactctcagcatattaaactaaagtcattggatgagcttacccagatgtgcataccgtac
tttgttgaagcaggatatatcaaagaggatgaggcacagtccaaatttgaatggctcaag
aagatagtaaaatctgtgtatgaaggactggattatctatctcagatcaaagacagagtt
gatgtatttttcaataatgaaataaaaatagaagaagatgaagcaaaagaggtcttaaag
tgggatcatgtgaaggatttaattaatgtattcgaaaataagataaggcagatgaatgaa
ttgactccagaagctattaagctacttttcaaagagattcaaaaagagacaggttacaag
ggcaaaaatctgtttatgccgataagagttgttttgactggcaaaacacacggtcctgag
cttgttgagataattgagattgtggggaaagaaaacatactaaaacgattggaattcttc
aaaacgtggtataattaa

DBGET integrated database retrieval system