KEGG   Caldicellulosiruptor kronotskyensis: Calkro_0584Help
Entry
Calkro_0584       CDS       T01357                                 

Definition
l-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Calkro_0584
Enzymes [BR:ckn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Calkro_0584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730254..731291
Genome map
AA seq 345 aa AA seqDB search
MRFLRLLKNKNEVWEFVVNMAIITRDLMVGNKKLEALGYPEETPGHNAILAGFQGQQQWT
DHFPNGDFMETILNSSFDWNGLRQTYILATENDSLNGVCMLFGHLLTNTAQIFADVRTYW
SPDAIYRVTGWKPEGLAQNGVIHLINSGSAALDGTGQQEIDGKPAIKPFWEITEQEVKKC
LDATRFCYANLGYFRGGGFSTKFVTRGGMPVTISRLNIVKGLGPVLQIAEGWTVELPANV
HEILDRRTDPTWPTTWFVPKLTGKGAFKSLYSVMENWGANHCAITYGHVGDLFITLASML
RIPVCIHNVEEERIFRPSAWSAFGTEDLEGADFRACKNFGPLYKK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagatttttgagactactaaaaaataagaatgaagtatgggaatttgtagtcaatatg
gctataataacaagagatttaatggttggtaacaaaaaacttgaagcattaggttatccc
gaagaaacacctggacataatgcaattttagcaggatttcaaggacagcagcagtggaca
gatcattttccaaacggtgactttatggaaacaattctcaattcctcatttgactggaat
ggactgagacagacctacatacttgcaactgaaaatgacagcttaaacggtgtatgtatg
ttatttgggcatttacttacaaatacagctcagatttttgcagatgttagaacatattgg
agtccggatgctatttacagagtaaccggatggaaaccagaaggacttgctcaaaatggg
gttattcatcttataaattctggttctgcagcattggatggaacaggtcagcaagagatt
gacggcaagcctgctataaagcctttctgggaaattaccgagcaagaagttaaaaaatgc
ttagatgcaacaagattttgttatgccaatttgggatattttagaggcggtggattttcg
actaagtttgtaacaagaggcggcatgcctgttacaatctcaagattaaatattgttaaa
ggtttagggccagtccttcaaattgcagaaggctggacagtagaacttcctgcaaatgtt
catgagatccttgatagaagaacagacccaacatggccaaccacatggtttgtaccaaaa
ctaactggcaagggagcatttaagagcctatactctgtgatggaaaactggggagcaaat
cattgtgcaataacctatgggcatgtgggtgatttatttatcacattggcttctatgtta
aggattcctgtatgtattcacaatgttgaagaagagagaatcttcagaccaagtgcctgg
agtgcatttgggacagaagatttggaaggtgcagattttagagcgtgcaaaaattttggc
ccactttataaaaaataa

DBGET integrated database retrieval system