KEGG   Caldicellulosiruptor kronotskyensis: Calkro_0788Help
Entry
Calkro_0788       CDS       T01357                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ckn00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
934066..936105
Genome map
AA seq 679 aa AA seqDB search
MGKIKLKKFLHGGDYNPDQWTEDVWEKDIEYMKYYNVNAVSMPIFSWAQLQPNEDEFTFE
WLDKIIDKLYSNGIHVILATPTASQPAWLSKKYPDVLPVDIHGRKRKHGARQNYCPNSPN
FKNAARRIVEEMVKRYKDHPAVIMWHISNEYGPYCYCENCAKAFREWLKERYKTLDELNK
RWNTAFWGHTFYDWDEIEVPSYLNEEFEYMPGRQKSSFQGLSLDYKRFMSDSLLNLYKME
VEIIKKYMPDIPVTTNLMGPFKPLDYHKWAKHMDIVSWDNYPSIKDSPSSIAFKHDLMRG
LKRDQSWILMEQTPSQTNWQWYNSAKRPGMIRLLSYHAIAHGADSVLYFQWRQSVASCEK
FHSAMVPHVGHLETRVSKELKKIGDEILRLDEILESTTKSEVALLFDWENWWALEESMGF
RNDISYLEHVDAYYRALYKLKTNVDVVDPKEELTRYKLVVAPLLYLLDQESAKNIENYVK
NGGIFITTYLSGLVDENDRVILGGYPGWFRKLCGIWVEEIDALFPDMKNAIILAKPIGIL
DGKYECDFICDIIHLEGARALAYYEQDYYCGMPAVVENNYGNGKAIYIGTRPEKRFIEGL
VKFYAEKAGIQPILPVPEGVEVTKREKNGNEYVFLLNFNGYDVNIELKDEYYELITQKVL
GGKATLAPKEVMILRRLKD
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaataaagctgaaaaaatttttgcatggtggagactacaatccagaccagtgg
acagaggatgtgtgggaaaaggacattgaatatatgaaatactataatgtaaatgcagtt
tctatgccaatattttcgtgggcacagcttcagccaaatgaagatgaatttacatttgaa
tggcttgacaaaataattgataagctctattcaaatggtattcatgtcatcttggcaaca
cctacggcttctcagccagcatggctttcaaaaaagtatcctgacgtgctgcctgttgat
attcacgggagaaagagaaagcacggagcaaggcagaattactgcccaaacagtccaaac
ttcaaaaatgcagcaagaagaattgttgaagagatggtaaaaaggtataaagaccatcct
gcagttataatgtggcatatcagtaacgagtatgggccttactgctactgtgaaaactgt
gctaaagcctttagagagtggttaaaagaaagatataaaacattagatgagctcaacaaa
agatggaacacagctttctggggacatacattttatgattgggatgagatagaagttcca
tcatatctgaacgaagagtttgaatatatgcctggaaggcagaaaagctcattccaggga
ctttcgcttgattacaagaggtttatgtcagacagccttctgaatctttataaaatggaa
gttgagattatcaaaaaatacatgccagatatccctgttacaacaaacctgatgggccca
tttaagcctcttgactatcacaaatgggcaaaacatatggatattgtatcatgggacaat
tacccatcgataaaagattctccaagttctattgctttcaagcatgacctcatgagaggg
ctcaaaagagaccaatcgtggattttgatggaacaaacgccgagccagacaaattggcag
tggtacaactctgcaaaaagacctggtatgatacggcttttgagctatcatgcgattgca
catggagctgactctgtgctttatttccagtggagacagtcagttgcttcatgcgaaaag
tttcactctgcaatggttccgcatgttgggcaccttgagacgagagtgagcaaagagctt
aaaaagattggcgacgaaattttacgcttggatgagattttggagtcaacaactaagagc
gaggttgcacttttatttgactgggaaaactggtgggcgcttgaagagagtatgggattt
agaaatgatatatcttaccttgaacatgtagatgcgtactacagagctctatataagttg
aaaacaaatgtggatgttgttgacccgaaagaagagttaacaaggtacaagcttgttgtt
gcaccacttttgtatcttctcgaccaagaaagtgcaaagaacatagaaaattatgtaaaa
aacggtggaatatttattacaacatatctatcaggacttgttgatgaaaacgacagagta
attcttggtggctatccgggttggttcaggaagctttgtggtatatgggttgaggagatt
gatgcgcttttccctgatatgaaaaatgcaattatacttgcaaaacctattggcatcctt
gatggaaaatacgaatgtgattttatatgcgatattattcaccttgagggtgcaagggcg
cttgcatactatgagcaggattattactgcggaatgccagctgttgttgaaaataattat
ggaaatggaaaggcgatttatattggaacaagaccagaaaaaaggtttatagaaggtctt
gttaagttctacgctgaaaaggctggtatacaaccaatattacctgtgccggaaggtgtt
gaagtaacaaaaagagaaaagaatgggaatgaatatgtgtttcttttgaatttcaatggt
tatgatgtaaatattgagcttaaagatgagtattatgagcttataacacagaaggttttg
ggcggaaaagctactcttgcaccgaaggaggttatgatactgagaagattaaaagattaa

DBGET integrated database retrieval system