KEGG   Caldicellulosiruptor kronotskyensis: Calkro_0890Help
Entry
Calkro_0890       CDS       T01357                                 

Definition
(RefSeq) phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calkro_0890
   01230 Biosynthesis of amino acids
    Calkro_0890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkro_0890
   00030 Pentose phosphate pathway
    Calkro_0890
   00051 Fructose and mannose metabolism
    Calkro_0890
   00052 Galactose metabolism
    Calkro_0890
  Energy metabolism
   00680 Methane metabolism
    Calkro_0890
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Calkro_0890
Enzymes [BR:ckn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calkro_0890
Protein phosphatases and associated proteins [BR:ckn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calkro_0890
Messenger RNA biogenesis [BR:ckn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Calkro_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1068365..1069612)
Genome map
AA seq 415 aa AA seqDB search
MPKEGNCVVAQSGGPTAVINASLLGVIEEAMKQHPIRAIYGAKNGIIGLIDEELYDLRME
DPEELKLLKTTPSSALGSCRYQLKPFEHDEKDYIKIFNVFEAHNIRYFFYIGGNDSMDTA
DKLTRYAQKIGYDICIIGIPKTIDNDLVMTDHCPGFGSAAKYIATSVMEIARDAVVYPTN
IVTIIEVMGRNAGWLAAASALASKDIGAPDLIYLPEVPFSIDKFLDDVRNIHKKTGKITI
VVSEGIKDKEGKYIADMSHKFGIDAFGHVQLGGAAFVLENIIREEVEKRVKSIQFNVLQR
SAAHIMSKTDVEEAYMVGRMAVRYAVEGACGYMVAIKRDSDNPYSSSTELVELNKVANAE
KLVPLAWISHDGNYVKEDALNYIQPLIEGEVEVKYERGLPRYAKLRKIMVPKKVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagaaggtaactgcgtggttgcgcaatcaggaggaccaactgctgtcatcaac
gcatcgcttttaggtgttattgaagaagctatgaaacagcacccaattcgtgctatttat
ggtgctaaaaatggaatcattggacttattgatgaagagctttatgacctcagaatggaa
gaccctgaagagctaaaacttttaaagacaactccatcctctgccttaggttcttgcagg
tatcagctcaagccttttgaacatgatgaaaaagactatatcaagatttttaatgtattt
gaggcgcataacattcgctactttttctatataggcggaaacgactcaatggatacagct
gataagcttacacgatacgcgcagaaaattgggtatgacatctgcataatcggaattcca
aagacaattgacaacgaccttgtgatgacagaccactgtccgggttttggaagtgctgca
aagtacattgcaacatctgtgatggaaattgcaagagatgcagttgtgtatccgacaaac
attgttactataattgaagtgatgggaagaaatgctggttggcttgcagcagcatctgct
ctggcatccaaagatataggtgcaccagatttaatatacctccctgaggttccattttcc
attgacaagtttttggatgatgtaagaaatattcacaagaaaactggaaagattaccatt
gttgtatcagaaggtattaaagacaaagaaggcaaatatattgctgatatgagccacaag
tttggaatagacgcgtttggacatgtacagcttggcggagcagcatttgttttagagaac
atcatccgcgaagaagtggaaaagagagtaaaatcaattcaattcaacgtgctacagcga
agtgctgctcacatcatgtccaaaactgatgttgaggaagcatacatggttggacgcatg
gcagtaaggtatgcggttgaaggtgcttgtggatacatggtagcaataaaacgcgacagt
gacaatccttattcaagttcaacagaacttgttgagctgaacaaggttgcaaacgctgaa
aagcttgtcccgcttgcgtggatttctcatgacggcaactatgtaaaagaagacgcttta
aattatatccagccactaattgaaggtgaagttgaagtcaagtacgaaagaggccttcct
cgatatgcaaagctcagaaagataatggttccaaagaaggttgtataa

DBGET integrated database retrieval system