KEGG   Caldicellulosiruptor kronotskyensis: Calkro_0903Help
Entry
Calkro_0903       CDS       T01357                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00900  Terpenoid backbone biosynthesis
ckn01100  Metabolic pathways
ckn01110  Biosynthesis of secondary metabolites
ckn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Calkro_0903
Enzymes [BR:ckn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Calkro_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Epimerase
Motif
Other DBs
NCBI-ProteinID: ADQ45775
UniProt: E4SDG6
Position
1081251..1082417
Genome map
AA seq 388 aa AA seqDB search
MTKSICILGSTGSIGVQTIDVATKLGIKVVGLSAYKNVALLIEQARELDPDILCIGDEKY
YTLLKENFPDKIVVTGQEGLISVATYPAADLIVNALVGISGLVPTVEAILAGKRVALANK
ETLVTGGKIIKRILSQKQAKDSIPVLIPVDSEHSAIFQCLVGEDKKNIKKIILTASGGPF
RGKKLKDLQSVNVEDVLKHPTWNMGRKITVDSATLINKGFEVIEAMFFFDKKCDDIDVVI
HPQSIIHSMVEFIDGSVKAQLSYPDMRLPIEYALTFPERGKAVAAPLDLVRVKNLTFEEP
DFDTFFLLKIAYECAKKGESYPIVLNAANEEAVKYFLEGKIGFVDIMKYVAKNIESHRGQ
KVESIQDVLEIDTETRQKFKNLVEGEKS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagagcatttgcatcctggggtcaaccgggtcaataggtgttcaaacaatagat
gttgcaacaaaacttgggattaaagttgtgggactttcagcatacaaaaatgttgctctt
ttgattgagcaggcaagagagcttgatcctgacattttatgtattggagatgagaagtac
tatactttattaaaagagaattttcctgataagatagttgtaacaggtcaggaagggcta
attagtgttgcaacatatccagcagcagatttgattgtaaatgcacttgttggtatatct
ggtttggtgccgacagttgaggctattttggcaggtaaaagagttgctcttgccaacaaa
gagacgcttgtgacaggtggaaagattataaaaaggattctttcccaaaaacaagcaaaa
gattctatccctgttcttattcctgttgactcagaacacagtgctattttccagtgcctt
gtaggtgaagacaaaaaaaatataaaaaagataattctcacagcatcaggaggacctttt
agaggcaaaaaactcaaagacttacaaagtgtcaatgtagaagatgtgctgaagcatcct
acgtggaacatgggtaggaaaatcacggttgattcagccaccctgataaacaaaggcttt
gaagtgatagaagccatgtttttctttgataaaaaatgtgatgatattgatgttgttata
catcctcaaagtattattcattcaatggttgaatttattgatgggtcagtaaaagcacag
ctatcttatcctgatatgcgtcttccgattgaatatgcgcttacttttcccgaaagaggc
aaagcagtagctgcgccacttgaccttgtaagagtaaaaaaccttacatttgaagagcct
gattttgatacattctttttgctcaaaattgcatatgagtgtgcaaaaaaaggagaaagt
tacccgattgtgctcaatgctgccaatgaagaggctgtaaaatatttcttggaagggaaa
attggctttgttgatattatgaagtatgtagctaaaaatattgaaagtcacagggggcaa
aaagtggaatccattcaggacgttttggaaattgatacggagacaaggcaaaagtttaaa
aatcttgtggaaggtgagaaaagctaa

DBGET integrated database retrieval system