KEGG   Caldicellulosiruptor kronotskyensis: Calkro_0903Help
Entry
Calkro_0903       CDS       T01357                                 

Definition
1-deoxy-d-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Calkro_0903
Enzymes [BR:ckn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Calkro_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081251..1082417
Genome map
AA seq 388 aa AA seqDB search
MTKSICILGSTGSIGVQTIDVATKLGIKVVGLSAYKNVALLIEQARELDPDILCIGDEKY
YTLLKENFPDKIVVTGQEGLISVATYPAADLIVNALVGISGLVPTVEAILAGKRVALANK
ETLVTGGKIIKRILSQKQAKDSIPVLIPVDSEHSAIFQCLVGEDKKNIKKIILTASGGPF
RGKKLKDLQSVNVEDVLKHPTWNMGRKITVDSATLINKGFEVIEAMFFFDKKCDDIDVVI
HPQSIIHSMVEFIDGSVKAQLSYPDMRLPIEYALTFPERGKAVAAPLDLVRVKNLTFEEP
DFDTFFLLKIAYECAKKGESYPIVLNAANEEAVKYFLEGKIGFVDIMKYVAKNIESHRGQ
KVESIQDVLEIDTETRQKFKNLVEGEKS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagagcatttgcatcctggggtcaaccgggtcaataggtgttcaaacaatagat
gttgcaacaaaacttgggattaaagttgtgggactttcagcatacaaaaatgttgctctt
ttgattgagcaggcaagagagcttgatcctgacattttatgtattggagatgagaagtac
tatactttattaaaagagaattttcctgataagatagttgtaacaggtcaggaagggcta
attagtgttgcaacatatccagcagcagatttgattgtaaatgcacttgttggtatatct
ggtttggtgccgacagttgaggctattttggcaggtaaaagagttgctcttgccaacaaa
gagacgcttgtgacaggtggaaagattataaaaaggattctttcccaaaaacaagcaaaa
gattctatccctgttcttattcctgttgactcagaacacagtgctattttccagtgcctt
gtaggtgaagacaaaaaaaatataaaaaagataattctcacagcatcaggaggacctttt
agaggcaaaaaactcaaagacttacaaagtgtcaatgtagaagatgtgctgaagcatcct
acgtggaacatgggtaggaaaatcacggttgattcagccaccctgataaacaaaggcttt
gaagtgatagaagccatgtttttctttgataaaaaatgtgatgatattgatgttgttata
catcctcaaagtattattcattcaatggttgaatttattgatgggtcagtaaaagcacag
ctatcttatcctgatatgcgtcttccgattgaatatgcgcttacttttcccgaaagaggc
aaagcagtagctgcgccacttgaccttgtaagagtaaaaaaccttacatttgaagagcct
gattttgatacattctttttgctcaaaattgcatatgagtgtgcaaaaaaaggagaaagt
tacccgattgtgctcaatgctgccaatgaagaggctgtaaaatatttcttggaagggaaa
attggctttgttgatattatgaagtatgtagctaaaaatattgaaagtcacagggggcaa
aaagtggaatccattcaggacgttttggaaattgatacggagacaaggcaaaagtttaaa
aatcttgtggaaggtgagaaaagctaa

DBGET integrated database retrieval system