KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1022Help
Entry
Calkro_1022       CDS       T01357                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ckn01100  Metabolic pathways
ckn01110  Biosynthesis of secondary metabolites
ckn01130  Biosynthesis of antibiotics
ckn01230  Biosynthesis of amino acids
Module
ckn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calkro_1022
Enzymes [BR:ckn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Calkro_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh NMO ThiG QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADQ45893
UniProt: E4SBB1
Position
1185695..1186477
Genome map
AA seq 260 aa AA seqDB search
MSVLERILSYKKEEVEKCKNLIPVEKMKKLAVEKIKGGYSENRFKRIFKKDKFCIIGEIK
RASPSEGVISEDANAKAIAKMYEDLGFFAISVLTERFFFKGSEQDLMEVKKVVSLPVLRK
DFIIDIWQLYQTKMIGADAALLITKALSEKQLAIFIKILEILDIVPLVEVENEYEIEKAL
KCGAKLIGINNRNLDDLSIDITKTERLLKYIPKEVAVISESGIKTKEDFDYILSLGVDGC
LIGTSFMKSQNPLEIIGDRI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcttgagcgtatcttgagctataaaaaggaagaggttgaaaagtgcaaaaat
ctcatacctgttgagaaaatgaagaaacttgcagttgagaagattaaaggtggctattcg
gaaaacaggttcaaaagaatattcaaaaaagataaattctgtataattggtgaaataaaa
agagcatcaccatcggagggtgtaatatcagaggatgctaatgcaaaagcaatagcaaag
atgtatgaagatttagggttttttgccatatcagttttgacagaaagattttttttcaag
ggttcagaacaagatttgatggaagtaaaaaaagtggtatctctgcctgtgctaagaaaa
gactttatcattgatatctggcagctttaccagacaaagatgataggcgcagacgcagct
ttgcttatcacaaaagctttgtcagagaagcagcttgcaatatttattaagattttggaa
attcttgacatagtaccgcttgttgaggttgaaaatgaatatgaaattgaaaaagctttg
aagtgtggtgcaaaactcataggaatcaacaacagaaacttagatgatttgtccatcgac
ataacaaagacagaaaggcttttgaagtatattccaaaggaagtcgctgtgataagcgaa
agtggaattaagacaaaagaggattttgactatattctctcgctcggtgttgatggatgt
ttgatagggacatcttttatgaaatcgcaaaatccgcttgaaataattggtgataggata
tga

DBGET integrated database retrieval system