KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1022Help
Entry
Calkro_1022       CDS       T01357                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ckn01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ckn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1185695..1186477
Genome map
AA seq 260 aa AA seqDB search
MSVLERILSYKKEEVEKCKNLIPVEKMKKLAVEKIKGGYSENRFKRIFKKDKFCIIGEIK
RASPSEGVISEDANAKAIAKMYEDLGFFAISVLTERFFFKGSEQDLMEVKKVVSLPVLRK
DFIIDIWQLYQTKMIGADAALLITKALSEKQLAIFIKILEILDIVPLVEVENEYEIEKAL
KCGAKLIGINNRNLDDLSIDITKTERLLKYIPKEVAVISESGIKTKEDFDYILSLGVDGC
LIGTSFMKSQNPLEIIGDRI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcttgagcgtatcttgagctataaaaaggaagaggttgaaaagtgcaaaaat
ctcatacctgttgagaaaatgaagaaacttgcagttgagaagattaaaggtggctattcg
gaaaacaggttcaaaagaatattcaaaaaagataaattctgtataattggtgaaataaaa
agagcatcaccatcggagggtgtaatatcagaggatgctaatgcaaaagcaatagcaaag
atgtatgaagatttagggttttttgccatatcagttttgacagaaagattttttttcaag
ggttcagaacaagatttgatggaagtaaaaaaagtggtatctctgcctgtgctaagaaaa
gactttatcattgatatctggcagctttaccagacaaagatgataggcgcagacgcagct
ttgcttatcacaaaagctttgtcagagaagcagcttgcaatatttattaagattttggaa
attcttgacatagtaccgcttgttgaggttgaaaatgaatatgaaattgaaaaagctttg
aagtgtggtgcaaaactcataggaatcaacaacagaaacttagatgatttgtccatcgac
ataacaaagacagaaaggcttttgaagtatattccaaaggaagtcgctgtgataagcgaa
agtggaattaagacaaaagaggattttgactatattctctcgctcggtgttgatggatgt
ttgatagggacatcttttatgaaatcgcaaaatccgcttgaaataattggtgataggata
tga

DBGET integrated database retrieval system