KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1025Help
Entry
Calkro_1025       CDS       T01357                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calkro_1025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calkro_1025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calkro_1025
Enzymes [BR:ckn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calkro_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1188259..1189029
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFEKLKKEGKKAFIGYVTFGYPTFEETLWFIKLVYSYVDILEIGFPFSDPIADG
EIIQKASIKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKKGIDRFFESCKACGVD
GVIIPDVSFEESFEFKESAEKFGVTYIDLVSISSLERAKMIGRQSRGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKHK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaagctaaaaaaagagggaaaaaaagctttcata
ggctatgttacgtttgggtatccaacttttgaagaaacactttggtttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatgga
gaaattattcaaaaagcttctataaaagctctcagtgaaggtgtcaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgttgtatgcaaac
acagtttacaaaaagggaattgataggttttttgaaagttgcaaagcttgcggtgtggat
ggcgtgataatcccagatgtttcgtttgaagagagctttgagtttaaagaatcagctgaa
aagtttggtgttacttatattgaccttgtatcaatatcttctcttgagagagcaaaaatg
ataggtaggcagagccgcggttttttgtattgtgtttcaagaaaaggcgtgacaggtttc
aaagggcagattgatgatagaatctttacttttctaaaagaactgaaaaccgttacatca
acacctttggcagttggatttggtataaagagtaaagaagatgttcagaagttcaaagac
cttgcagatggtattgtcattggaagcgcaataatcacaaagatagatgaaggaaaagac
aagcttgaagattttttgaaagaaatctctgaaagtctaaaacacaaataa

DBGET integrated database retrieval system