KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1025Help
Entry
Calkro_1025       CDS       T01357                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calkro_1025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calkro_1025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calkro_1025
Enzymes [BR:ckn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calkro_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188259..1189029
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFEKLKKEGKKAFIGYVTFGYPTFEETLWFIKLVYSYVDILEIGFPFSDPIADG
EIIQKASIKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKKGIDRFFESCKACGVD
GVIIPDVSFEESFEFKESAEKFGVTYIDLVSISSLERAKMIGRQSRGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKHK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaagctaaaaaaagagggaaaaaaagctttcata
ggctatgttacgtttgggtatccaacttttgaagaaacactttggtttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagatgga
gaaattattcaaaaagcttctataaaagctctcagtgaaggtgtcaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgttgtatgcaaac
acagtttacaaaaagggaattgataggttttttgaaagttgcaaagcttgcggtgtggat
ggcgtgataatcccagatgtttcgtttgaagagagctttgagtttaaagaatcagctgaa
aagtttggtgttacttatattgaccttgtatcaatatcttctcttgagagagcaaaaatg
ataggtaggcagagccgcggttttttgtattgtgtttcaagaaaaggcgtgacaggtttc
aaagggcagattgatgatagaatctttacttttctaaaagaactgaaaaccgttacatca
acacctttggcagttggatttggtataaagagtaaagaagatgttcagaagttcaaagac
cttgcagatggtattgtcattggaagcgcaataatcacaaagatagatgaaggaaaagac
aagcttgaagattttttgaaagaaatctctgaaagtctaaaacacaaataa

DBGET integrated database retrieval system