KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1080Help
Entry
Calkro_1080       CDS       T01357                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calkro_1080
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Calkro_1080
Enzymes [BR:ckn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Calkro_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1237545..1238345
Genome map
AA seq 266 aa AA seqDB search
MRDFGNAKKIVVKVGTSTVTYPTGKLNLSRLEKLARVLSDIKNEGRDVVLVTSGAVASGL
GRLGLTKNHKTTQEKQALAAIGQGILMQIYEKLFGEYGVVVAQVLLTKDVVDEEKKMLNV
KNTFEYLFKYGAIPIVNENDVVAIEELEFGDNDTLSAYVATIIGADLLIILSDIDGLYSC
DPRIDKSAELIKEVFEIDSYIESIAGGAGTLNSTGGMQTKIEAAKIAMQHGIPMVIANGE
NPSIVKEILEGKEIGTLFVSKNAVSR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcgagactttggaaatgcaaaaaagattgttgtaaaggttgggacaagtactgtaaca
tatccaaccggcaaattaaatctttcgcgtttagaaaaacttgcaagagttctttctgac
ataaaaaatgaaggaagggacgttgtgcttgtcacatctggcgctgttgcatcagggtta
ggaaggcttgggcttaccaagaatcacaaaacaacgcaggaaaaacaagcacttgcggca
attggccaaggaattttaatgcagatttatgaaaagctttttggtgaatacggagttgtg
gttgctcaggtgcttcttaccaaggatgttgttgatgaagagaagaagatgctaaatgtt
aagaacacatttgagtacctgttcaaatatggtgcaattccaattgtgaacgaaaacgac
gttgttgcaattgaagagcttgagtttggcgacaacgatactttgtctgcttatgttgcc
acaataattggtgctgaccttttgattatcctttctgacatagatgggctttattcatgt
gacccgagaattgacaagagtgcagagcttataaaagaggtttttgagattgactcatat
atagaaagcattgcgggcggtgctggcactctcaactcaacaggcggtatgcaaaccaaa
attgaagctgctaagattgcaatgcaacatgggattcctatggttattgcaaatggcgaa
aatccatcaattgtaaaagagatcttagagggcaaagagataggaaccttatttgttagt
aaaaatgccgtttcgagataa

DBGET integrated database retrieval system