KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1176Help
Entry
Calkro_1176       CDS       T01357                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ckn00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1347058..1347927
Genome map
AA seq 289 aa AA seqDB search
MKLKAYAKINLALDVLSKREDGYHEIRTIMQTVDLYDIINIEKIEEDSIIVTTSSENIPT
DNKNHAYIAASLLKERFGVKQGVKIHIEKNIPVSAGLAGGSTDAAAVLKGLNEIFELNLS
QQQLMEIGREIGADVPFCLVGGTALCEGIGEKVLKLKSAPQMNILIAKPEVYVSTQAVYE
ALDISKVKKRPNIEAMISAIEEGNVKEIAKNLCNVLEAVTVNQYPVINRVKDIMRNNNAL
GTVMTGSGPAVFGIFGNKYDALKAAERLKVFIKEIILTTTCEGSGVLEF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactcaaggcttatgcaaaaatcaacttagcattagatgtactttcaaaaagggaa
gatggttatcatgagataagaactataatgcaaacagtagatttgtatgatataatcaat
attgaaaagatagaagaagacagtataattgtaacaacttcaagtgaaaatattccaact
gacaataaaaaccatgcatacattgcagcttcacttttaaaagagcgttttggtgtaaag
caaggtgtgaaaatacatattgagaagaacattccggtctctgcaggtttagctggtgga
agcactgacgcagcagcagttttaaaaggtctgaatgaaatatttgagttaaatctttct
cagcagcagcttatggaaattggaagagagattggtgctgatgttccattttgtttggta
ggtggaacagctctttgtgagggaattggcgaaaaggttttaaaattaaaatcagctcct
cagatgaatatccttattgcaaagccagaggtctatgtttccacacaggctgtatatgag
gcacttgacattagcaaagtaaaaaagagaccaaacattgaagctatgatttcggcaatt
gaagaaggtaatgtaaaagagatagcaaagaacctttgcaatgttttagaggcggttaca
gtaaatcagtatccagtcataaacagagtcaaggacattatgagaaataacaatgctctt
ggaacagttatgacaggaagtggaccggctgtatttgggatttttggtaacaagtatgat
gctttaaaagctgcagagaggcttaaggtgtttataaaagaaataatcttgactacaaca
tgtgaaggcagtggagttttggaattttag

DBGET integrated database retrieval system