KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1176Help
Entry
Calkro_1176       CDS       T01357                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00900  Terpenoid backbone biosynthesis
ckn01100  Metabolic pathways
ckn01110  Biosynthesis of secondary metabolites
ckn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Calkro_1176
Enzymes [BR:ckn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Calkro_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C YcaO
Motif
Other DBs
NCBI-ProteinID: ADQ46037
UniProt: E4SD21
Position
1347058..1347927
Genome map
AA seq 289 aa AA seqDB search
MKLKAYAKINLALDVLSKREDGYHEIRTIMQTVDLYDIINIEKIEEDSIIVTTSSENIPT
DNKNHAYIAASLLKERFGVKQGVKIHIEKNIPVSAGLAGGSTDAAAVLKGLNEIFELNLS
QQQLMEIGREIGADVPFCLVGGTALCEGIGEKVLKLKSAPQMNILIAKPEVYVSTQAVYE
ALDISKVKKRPNIEAMISAIEEGNVKEIAKNLCNVLEAVTVNQYPVINRVKDIMRNNNAL
GTVMTGSGPAVFGIFGNKYDALKAAERLKVFIKEIILTTTCEGSGVLEF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactcaaggcttatgcaaaaatcaacttagcattagatgtactttcaaaaagggaa
gatggttatcatgagataagaactataatgcaaacagtagatttgtatgatataatcaat
attgaaaagatagaagaagacagtataattgtaacaacttcaagtgaaaatattccaact
gacaataaaaaccatgcatacattgcagcttcacttttaaaagagcgttttggtgtaaag
caaggtgtgaaaatacatattgagaagaacattccggtctctgcaggtttagctggtgga
agcactgacgcagcagcagttttaaaaggtctgaatgaaatatttgagttaaatctttct
cagcagcagcttatggaaattggaagagagattggtgctgatgttccattttgtttggta
ggtggaacagctctttgtgagggaattggcgaaaaggttttaaaattaaaatcagctcct
cagatgaatatccttattgcaaagccagaggtctatgtttccacacaggctgtatatgag
gcacttgacattagcaaagtaaaaaagagaccaaacattgaagctatgatttcggcaatt
gaagaaggtaatgtaaaagagatagcaaagaacctttgcaatgttttagaggcggttaca
gtaaatcagtatccagtcataaacagagtcaaggacattatgagaaataacaatgctctt
ggaacagttatgacaggaagtggaccggctgtatttgggatttttggtaacaagtatgat
gctttaaaagctgcagagaggcttaaggtgtttataaaagaaataatcttgactacaaca
tgtgaaggcagtggagttttggaattttag

DBGET integrated database retrieval system