KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1499Help
Entry
Calkro_1499       CDS       T01357                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Calkro_1499
Enzymes [BR:ckn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Calkro_1499
Exosome [BR:ckn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calkro_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1669293..1670270)
Genome map
AA seq 325 aa AA seqDB search
MEFKRLRRLRQTKALRELFYETRLYSKEFIFPLFIDDGKNVFERMPQLDGIVKVSVDRLY
EILDEIKKADIGGVILFGVTSQKDEMGSYATKDDGAVQQAIRKIKEYSEDILVFADVCLC
EYTSHGHCGILQGNKIDNDKTIEVLSEIALSYAKAGADIICPSDMMDGRVAAIREKLDSH
GFVYTPIIPYSAKFASSLYAPFRDVANSRPAFGDRKSYQMPYQNKREALREIEADILEGA
DAVIIKPALTSLDVIFVAKEKFNIPIIAYNVSGEYAMVKSAGKLGFLNEKEIMIEILTAI
KRAGADAIITYHALEAAKILNRKEL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaaagattaagaaggttaagacagacaaaagctttaagagaacttttttat
gaaacaagactttacagcaaagagtttatttttccactatttattgatgatggtaaaaac
gtgtttgaaagaatgccgcaattagatggcattgtgaaggtatctgttgacagactatat
gaaattttggatgaaatcaagaaagctgacattggcggtgtaattttgtttggtgtgact
tcacagaaagatgagatgggcagttatgctaccaaggatgatggggcagtccagcaggca
ataaggaaaataaaagaatattctgaagatatattagtgtttgcagatgtgtgcctttgt
gagtacacatctcatggacattgcggtattttgcaaggcaataaaatagacaatgataag
acaatagaagttttaagtgaaatagcactgtcctatgcaaaagcaggggcagatataatt
tgtccatctgatatgatggacggaagggttgctgctatccgtgagaaacttgacagtcac
ggatttgtttatactcccattataccatacagtgcaaagtttgcatcctcactttatgcg
ccatttagagatgtagcaaactcacggcctgcttttggcgacagaaaaagttatcaaatg
ccataccaaaacaaaagagaagctctgcgagagatagaagctgatattttagaaggcgcc
gatgctgtaattataaaacctgccttgacatcacttgatgtaatttttgtggcaaaagag
aaattcaatattcctattatagcttataatgttagcggcgagtatgccatggtaaaaagt
gctggcaagcttggttttttgaatgaaaaagagataatgattgaaatattgactgcaata
aagagagcaggtgctgatgcgattataacgtaccatgctttagaggctgcaaagatatta
aatcgaaaggagctgtaa

DBGET integrated database retrieval system