KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1545Help
Entry
Calkro_1545       CDS       T01357                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00040  Pentose and glucuronate interconversions
ckn00052  Galactose metabolism
ckn00500  Starch and sucrose metabolism
ckn00520  Amino sugar and nucleotide sugar metabolism
ckn01100  Metabolic pathways
ckn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Calkro_1545
   00052 Galactose metabolism
    Calkro_1545
   00500 Starch and sucrose metabolism
    Calkro_1545
   00520 Amino sugar and nucleotide sugar metabolism
    Calkro_1545
Enzymes [BR:ckn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Calkro_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: ADQ46400
UniProt: E4SF75
Position
complement(1715111..1716019)
Genome map
AA seq 302 aa AA seqDB search
MKRIIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILIVTGR
GKRAIEDHFDKSFELEVALENKKDYDNLQLIRKIADYNVHYIRQKEPRGLGDAVYCARLF
IDNEPFAVLLGDDIIISEKPCLKQLIEVYEEYRTTILGVQKVSDDDVSKYGIVAGKQIED
RIYKVKDLVEKPKKEEAPSNIAVLGRYIITPEILNILEHTKEGVGGEVQLTDALRELSKK
EAMYAYEFEGKRYDVGNKLGFLQATVEIALSRKDIGKDFYNYLVTLVNAKNYKEKLHELE
EI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagaattattaaaaaagcaatcattcctgcggcaggacttggaacaaggtttttg
ccggcaacaaaggcacagccaaaagagatgcttcccattgtggacaagccaacaattcaa
tacatagttgaagaagcgttagaatcggggatagagagtattttaattgttacagggcgt
ggcaaaagagcaattgaagaccactttgacaagtcttttgaacttgaagttgcacttgaa
aacaagaaggattatgataatcttcagctaataagaaaaatagcagactacaatgttcat
tacatacgtcaaaaagagccaagaggacttggtgatgcagtatactgtgcaagacttttt
attgacaatgaaccttttgcagttttgcttggtgatgatatcatcatttctgaaaagcca
tgtttgaaacagctgatagaggtgtatgaagagtacaggacaaccatcctgggtgtgcaa
aaagtatcagatgatgatgttagcaagtatggaattgtggcaggaaaacaaatagaagat
agaatctataaggtaaaggaccttgttgaaaaaccaaaaaaggaagaagcaccttcgaat
atcgctgtgcttggaagatatatcatcactcctgagatattaaatatcttggaacacaca
aaagaaggtgttggtggagaagtacagctgacagatgccttaagagaactttcaaaaaaa
gaagctatgtatgcttatgagtttgaagggaaaagatatgatgtgggcaataaacttgga
tttttgcaagcaacagttgagattgctctttcaagaaaagacattggcaaagatttttac
aattatcttgttactcttgtaaatgccaaaaattataaagagaaattacacgaattagaa
gaaatttaa

DBGET integrated database retrieval system