KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1590Help
Entry
Calkro_1590       CDS       T01357                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ckn00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ckn00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ckn00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1758774..1760090)
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRDSTIALMDIDSIRLEFMRKALQKLIEQEKYP
TKLEATTDRKEALKGAKYVIVTIQVGGLKPFEYDIYIPLKYGVKQAVGDTIGPGGVFRAL
RTIPVLLDIAKDMEELCPDALLLNYVNPMAMNCWALNKATNIKNVGLCHSVQGTAEFLAK
IIGAKMEEVSYLCAGINHMAWFLKFEWSGKDAYPLIREKANDPEIYTQDVTKFEILKHFG
YYVSESSFHMSEYVPYFRKSDDWINKIHRTHSWHKEHYNGMYLHCCLDAAKTLLEDLKKM
AEADYIDPKRSNEYCATIIHSIETNTPSVINGNVENKGLIKNLPEGCCVEVPCLVDKNGI
QPTYVGDLPPQLAALNRTNINVQELTVLAALTGDREAVYHAIMMDPLTSAVLDLDEIRQM
VDEMFEAEKEWLPEKFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagctatcataggggcgggaagtggagttttcacaaggaacttagtaaga
gacattttgtcatatccagagctaagagactctacaatagcgcttatggacattgacagt
ataaggcttgaatttatgagaaaagctctgcaaaagctcattgaacaggaaaagtatcct
actaaacttgaagctacaactgatagaaaagaggctttaaaaggtgcaaaatatgttatt
gtcacaatacaggttggaggtttaaaacctttcgagtatgacatttacattcctctaaaa
tacggtgtaaaacaggcagttggcgatacaataggtccaggtggagttttcagagctctt
agaacaataccggttttacttgacattgcaaaggacatggaagagctgtgtcctgacgca
cttttgctcaattatgtaaatccaatggcaatgaattgctgggcgttaaataaggctacg
aatataaaaaatgtagggctttgtcatagtgttcaaggaactgctgaatttttagcaaag
attattggtgcaaaaatggaagaggtttcatacttatgcgcaggtataaaccacatggcg
tggtttttaaaatttgagtggagtgggaaagatgcgtatcctcttataagagaaaaagca
aatgaccccgagatttatacccaggatgttaccaagttcgagatactaaaacattttgga
tattatgtttcagagtcaagttttcacatgtctgaatatgttccctattttaggaagagc
gacgattggataaataaaatccatagaacacattcatggcacaaagaacattacaatggt
atgtatttgcattgctgcttagatgctgcgaaaactttgcttgaggacctaaaaaaaatg
gcagaggcagactacatcgacccgaaaagaagtaacgaatattgtgcaactatcatccat
tctatagagacaaatactccaagtgtgataaatggtaatgttgagaacaagggtttgata
aaaaatttgcctgaaggatgctgtgttgaagtgccatgcttggttgacaaaaatggtatt
cagccaacttatgtgggagatctaccaccacagcttgcagctttgaatagaacaaatata
aacgttcaagagctaactgttcttgctgctttgacaggtgatagggaagcagtttatcat
gcaattatgatggaccctctcacaagtgcagttttagatttggatgaaatacgacagatg
gtagacgagatgtttgaagctgaaaaagaatggctgccagaaaagttttataggtaa

DBGET integrated database retrieval system