KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1659Help
Entry
Calkro_1659       CDS       T01357                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00230  Purine metabolism
ckn01100  Metabolic pathways
Module
ckn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Calkro_1659
Enzymes [BR:ckn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Calkro_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 AAA_16 AAA_28 AAA_30 cobW
Motif
Other DBs
NCBI-ProteinID: ADQ46511
UniProt: E4SFI6
Position
complement(1826529..1827128)
Genome map
AA seq 199 aa AA seqDB search
MKEGLLIVISGPAGTGKGTVVGRLLEKNPNIKLSISKTTRKPRPGEKEGVNYFFVSREQF
EEEIKNERFLEYAEYNNNYYGTPKDFVFEALGKGYDVILEIETKGALQIKKVFSDAVLIF
LLPPSIEELYKRLIKRGTESEDEIRARLEIAKSEIKLVPEYDYCVINDNVDDAAEKIQKI
IEVEKLKSRRFDIQSFLKE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaggacttttgattgtgatttcagggccagcagggactggaaagggtacagtt
gttggaaggcttcttgaaaaaaatcccaatattaaactttcaatttccaaaacaacaaga
aagccaagaccaggagaaaaagagggtgtgaattatttttttgtctcgcgcgagcaattt
gaagaagagattaaaaatgaaagatttttagaatatgctgagtataacaataactattat
ggtacgcccaaagactttgtctttgaagcattgggaaaaggctatgatgtaattttggag
attgagacaaaaggagcacttcagattaaaaaagtattttcggatgcagtactgatattt
ttactgccaccatccatagaagagctttacaaaagacttataaaaagaggcactgagtcg
gaagatgaaataagagcaaggcttgagattgcgaaaagtgagataaaacttgtgccagag
tatgactattgtgttataaatgacaatgtggatgatgctgctgaaaagatacaaaagatt
attgaagttgaaaaactgaagagtaggagatttgatatacaaagttttttgaaggagtga

DBGET integrated database retrieval system