KEGG   Caldicellulosiruptor kronotskyensis: Calkro_1779Help
Entry
Calkro_1779       CDS       T01357                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ckn  Caldicellulosiruptor kronotskyensis
Pathway
ckn00010  Glycolysis / Gluconeogenesis
ckn00020  Citrate cycle (TCA cycle)
ckn00620  Pyruvate metabolism
ckn00633  Nitrotoluene degradation
ckn00640  Propanoate metabolism
ckn00650  Butanoate metabolism
ckn00680  Methane metabolism
ckn01100  Metabolic pathways
ckn01120  Microbial metabolism in diverse environments
ckn01130  Biosynthesis of antibiotics
ckn01200  Carbon metabolism
Module
ckn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ckn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calkro_1779
   00020 Citrate cycle (TCA cycle)
    Calkro_1779
   00620 Pyruvate metabolism
    Calkro_1779
   00640 Propanoate metabolism
    Calkro_1779
   00650 Butanoate metabolism
    Calkro_1779
  Energy metabolism
   00680 Methane metabolism
    Calkro_1779
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calkro_1779
Enzymes [BR:ckn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calkro_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_3 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ADQ46628
UniProt: E4SFV3
Position
complement(1941237..1941536)
Genome map
AA seq 99 aa AA seqDB search
MRKMKITEDVTWKEITPAGVIIDPGNAEDFKTGDWRTMRPVWHEDKCKQCLFCFYVCPDS
SIKVENGKMVGVDYDHCKGCGVCTEVCPFKAFDFVEEKK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatgaaaataacagaggatgttacatggaaggaaataacaccagcaggtgta
attatagacccgggtaatgcagaggactttaaaacaggcgactggagaacaatgagacct
gtatggcatgaagataagtgcaagcagtgtctgttctgcttctatgtatgtccagattca
tcaataaaggttgaaaatgggaagatggtcggagttgactatgaccactgcaaaggttgc
ggggtttgcacagaggtttgtccatttaaagctttcgattttgtagaggagaagaaataa

DBGET integrated database retrieval system